Conserved Protein Domain Family
PRK00611

?
PRK00611: PRK00611 
putative disulfide oxidoreductase; Provisional
Statistics
?
PSSM-Id: 100616
View PSSM: PRK00611
Aligned: 14 rows
Threshold Bit Score: 190.006
Threshold Setting Gi: 15604896
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15604896    1 MIKHLRSYCLYLAWLFSCIGTLMSVYYSYILNVEPCLLCYYQRICLFPLVVILGIAAYREDISIKIYTLPLALVGFGIAI 80
gi 166154386   1 MIKHLRSYCLYLAWLFSCIGTLMSVYYSYILNVEPCLLCYYQRICLFPLVVILGIAAYREDISIKIYTLPLALVGFGIAI 80
gi 166155261   1 MIKHLRSYCLYLAWLFSCIGTLMSVYYSYILNVEPCLLCYYQRICLFPLVVILGIAAYREDISIKIYTLPLALVGFGIAI 80
gi 237802600   1 MIKHLRSYCLYLAWLFSCIGTLMSVYYSYILNVEPCLLCYYQRICLFPLVVILGIAAYREDISIKIYTLPLALVGFGIAI 80
gi 237804522   1 MIKHLRSYCLYLAWLFSCIGTLMSVYYSYILNVEPCLLCYYQRICLFPLVVILGIAAYREDISIKIYTLPLALVGFGIAI 80
gi 62185179    1 MIRFLRNYALYFAWLISCTGTVMSIYYSYLLNIEPCVLCYYQRICLFPLSIILGIATYREDDLVKIYALPLSIMGMLIAV 80
gi 29840345    1 MIRFLRNNALYFAWLICSTGTVMSIYYSYLLNIEPCVLCYYQRICLFPLSIILGIATYREDNLVKIYALPLSITGMVIAV 80
gi 16752812    1 MINFIRSYALYFAWAISCAGTLISIFYSYILNVEPCILCYYQRICLFPLTVILGISAYREDSSIKLYILPQAVLGLGISI 80
gi 15618151    1 MINFIRSYALYFAWAISCAGTLISIFYSYILNVEPCILCYYQRICLFPLTVILGISAYREDSSIKLYILPQAVLGLGISI 80
gi 15835762    1 MINFIRSYALYFAWAISCAGTLISIFYSYILNVEPCILCYYQRICLFPLTVILGISAYREDSSIKLYILPQAVLGLGISI 80
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*
gi 15604896   81 YQVCLQEIPGMTLDICGKVSCSTKLFLLGFITMPMASAAAFCAIACLLVLATKSK 135
gi 166154386  81 YQVCLQEIPGMTLDICGKVSCSTKLFLLGFITMPMASAAAFCAIACLLVLATKSK 135
gi 166155261  81 YQVCLQEIPGMTLDICGKVSCSTKLFLLGFITMPMASAAAFCAIACLLVLATKSK 135
gi 237802600  81 YQVCLQEIPGMTLDICGKVSCSTKLFLLGFITMPMASAAAFCAIACLLVLATKSK 135
gi 237804522  81 YQVCLQEIPGMTLDICGKVSCSTKLFLLGFITMPMASAAAFCAIACLLVLATKSK 135
gi 62185179   81 YQICLQEIAGMTIDICGRVSCSTKLFIFGFITIPMASALAFCAISCLLILSDSKK 135
gi 29840345   81 YQICLQEISGMTIDICGRVSCSTKLFVFGFITVPMASALAFCAISCLLILSGSKK 135
gi 16752812   81 YQVFLQEIPGMQLDICGRVSCSTKIFLFSYVTIPMASVVAFGAIVCLLVLTKKYR 135
gi 15618151   81 YQVFLQEIPGMQLDICGRVSCSTKIFLFSYVTIPMASVVAFGAIVCLLVLTKKYR 135
gi 15835762   81 YQVFLQEIPGMQLDICGRVSCSTKIFLFSYVTIPMASVVAFGAIVCLLVLTKKYR 135
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap