Conserved Protein Domain Family
PRK00647

?
PRK00647: PRK00647 
hypothetical protein; Validated
Statistics
?
PSSM-Id: 100624
View PSSM: PRK00647
Aligned: 13 rows
Threshold Bit Score: 161.573
Threshold Setting Gi: 16752546
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161723222   1 MLEGFWVLEVRVTTKARENRVVCLEDGILRVRVTEVPEKGKANDAVVALLANFLSIPKSDVTLIAGEASRRKKVLLPRSI 80
gi 162019865   1 MLEGFWVLEVRVTTKARENRVVCLEDGILRVRVTEVPEKGKANDAVVALLANFLSIPKSDVTLIAGEASRRKKVLLPRSI 80
gi 166154599  16 LLEGFWVLEVRVTTKARENRVVCLEDGILRVRVTEVPEKGKANDAVVALLANFLSIPKSDVTLIAGEASRRKKVLLPRSI 95
gi 166155474  16 LLEGFWVLEVRVTTKARENRVVCLEDGILRVRVTEVPEKGKANDAVVALLANFLSIPKSDVTLIAGEASRRKKVLLPRSI 95
gi 237802813  16 LLEGFWVLEVRVTTKARENRVVCLEDGILRVRVTEVPEKGKANDAVVALLANFLSIPKSDVTLIAGEASRRKKVLLPRSI 95
gi 237804735  16 LLEGFWVLEVRVTTKARENRVVCLEDGILRVRVTEVPEKGKANDAVVALLANFLSIPKSDVTLIAGEASRRKKVLLPRSI 95
gi 15835282    1 MLEGFWVLEIRVTTKARENKVVSLEDGILRVRVTEAPERGKANDAVVALLAKFLSIPKNDVTLIAGEASRRKKVLLPRAI 80
gi 62184885    1 MHQEYWILEVKVTPKSKQNTIVGFEGEVLKIRVTEVPEKGKANEAVIALLAKALSLPKRDITLIPGDTSRKKRILLPKST 80
gi 29840014    1 MNEEYWILEVKVTPKSRENKIVGFEGEVLKIRVTEAPEKGKANEAVIALLAKTLSLPKRDVTLISGETSRKKRLLLPKST 80
gi 16752546    1 -MDDSWILEVKVTPKAKENKIVGFDGQALKVRVTEPPEKGKANDAVISLLAKALSLPKRDVTLIAGETSRKKKFLLPNRV 79
gi 15618408    1 -MDDSWILEVKVTPKAKENKIVGFDGQALKVRVTEPPEKGKANDAVISLLAKALSLPKRDVTLIAGETSRKKKFLLPNRV 79
gi 15836028    1 -MDDSWILEVKVTPKAKENKIVGFDGQALKVRVTEPPEKGKANDAVISLLAKALSLPKRDVTLIAGETSRKKKFLLPNRV 79
gi 33241848    1 -MDDSWILEVKVTPKAKENKIVGFDGQALKVRVTEPPEKGKANDAVISLLAKALSLPKRDVTLIAGETSRKKKFLLPNRV 79
                         90
                 ....*....|....*.
gi 161723222  81 KAFLLEQFPSESSSTT 96
gi 162019865  81 KAFLLEQFPSESSSTT 96
gi 166154599  96 KAFLLEQFPSESSSTT 111
gi 166155474  96 KAFLLEQFPSESSSTT 111
gi 237802813  96 KAFLLEQFPSESSSTT 111
gi 237804735  96 KAFLLEQFPSESSSTT 111
gi 15835282   81 KAFLFEQFPQTSSPDA 96
gi 62184885   81 ESIVSHWREKGFYAGL 96
gi 29840014   81 ESIISHWREHGL---- 92
gi 16752546   80 QDIIFSLHIDV----- 90
gi 15618408   80 QDIIFSLHIDV----- 90
gi 15836028   80 QDIIFSLHIDV----- 90
gi 33241848   80 QDIIFSLHIDV----- 90
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap