Conserved Protein Domain Family
PRK01156

?
PRK01156: PRK01156 
chromosome segregation protein; Provisional
Statistics
?
PSSM-Id: 100796
View PSSM: PRK01156
Aligned: 3 rows
Threshold Bit Score: 1059.51
Threshold Setting Gi: 48477311
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13541058   1 MIIERIRLRNFLSHSDSDIYFDTGINMIIGQNGAGKSSIVDAIRFALFSDKR-TRRTEDMIKKGERYMEVELYFRSEGHS 79
gi 16081317   1 MIIDRIRLINFLSHEDSEIFFDTGVNIIVGHNGAGKSSIIDAIRFALFGDKR-TKKIEDMIRKGAKSLEVEMEFRHGGHT 79
gi 48477311   1 MIIKSLKLKNFVSYDDAEIEFTPGITIITGKNGAGKTSIVDAIKFALFTETRnSEKIEEMVKKGKNNLSVMLEFYIGSDV 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13541058  80 YRIRRTIERRGKSISTDAEIERDGSIITRGASDVSNYVEKNVLNINKDVFLTSIFVRQGEMDALVSKDPAERKKILDEIL 159
gi 16081317  80 YIIRRSITRRSKNPESNAMIMVDGSALSQSVKDANDYIEKNIITKSKDVFLNSVFSKQGEMDDLISGDPARRKKLLDEIL 159
gi 48477311  81 YQVFRSY-KFGKGSRRESYIKKNNEIIAEGFDQTTKAIE-NILGISKDVFKNSIFVGQGEMDSLISGTPKQRKEIFSEIL 158
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13541058 160 NIDRLEAGYLLLKEVIDDLTANVSDYDYL-------KNELQSKINEIDNNNKQIEELESKLRLIEPEIKALEEEINIKEN 232
gi 16081317 160 EIEKLEETYDVLKDVIDSLQAGISNLDYLisenerdRDDLRRYQDDVAELSKQIDQEEAIESDLLRKKEEASAEYNAVSK 239
gi 48477311 159 EINSLSRNADKLKDVLKMLRPEISNINDV-------EEKLKSSNLELENIKKSLADDEKSHSITLKEIERLSIVYQNAMD 231
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13541058 233 KKDHLNEELHRLNAQLETIKKYEMELAESQSRKAsiemevvKLPSIEEELKRLENNAAVVKRNEIIEYINLKKDLGSLSE 312
gi 16081317 240 ELIMLDATLKNMMSLSDEANRYEEEIRKIDGKLQ-------EISGSTERYNEITSSKVYASRERIRGYWTDKGQIIDYRK 312
gi 48477311 232 DYNNAKSAMNELSSLEDMKNRLNSDIKTAESDLSmeleknnYYKELEERHMKIINDPVYKNRNYINDYFKYINDIENKKQ 311
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13541058 313 IIEGLKSDLSKYDEAHRKLEDLQSFRSEFLEKKKRKEDLDKLRSSLKEDEDNYQSAVRNIENIKKWIENEEKEIERMSAF 392
gi 16081317 313 MLKNIDGQVQSYEDNMKKAAELQADHDQYEIMQRRMDEIKHELDDLRTYESKYVSLINEIEQKKKKREEYRKKQKDLGDE 392
gi 48477311 312 ILSNIDAEINKYHAIIKKLSVLEKDYNDYIKKKSEYDDLNNQILELEGYHMDYNGYLKSYESLNMKIREYSIN------- 384
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13541058 393 ISEILKIQEITPEIINSRRAEINSSLMQIEGKIASLNASIDAMRSHKMEVEENAAMLSGRGVCPVCGTHLGTEKSEDLVK 472
gi 16081317 393 ISRTLGRAFANASELVAIYEEIRRDIDEINTDLGNLQVKIGALRQKEEEIRRNMNMLEGHNKCPVCGTDLGDEGSRRIRE 472
gi 48477311 385 ---------IDPDAIKKELNEINVKLQDYSSKVSSLNQRKRSLIENLDELSRNMEILNGQSVCPVCGTTLGEDKINHIIN 455
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13541058 473 HYGEEASRLEEDINKTENEIKKLDEERKHQKKLLDRINGKDVERLIASYNLLSSKRAELKKFMDDEARLKEAHLKAEAAI 552
gi 16081317 473 HYSEDLNRLNEEIDHLEREASAIDEKKRQLISMESYLAKGKIREYETYDRQMKDLEAQITDDENSLSTIAYKHTKYEQLD 552
gi 48477311 456 DYNNKKSGIESKIREIEIDVKDINNKIVDLKKRKEYLESEEINKSINEYNKIESARHDLEDIKIKINELKDKEDKYNEIK 535
                       570       580       590       600       610       620       630       640
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13541058 553 SQYNSID--LGDLEAKNEEWLKANAVISSI-DIENIRSRFEEKNKQLNDIIKRMNEI--EVNIPDVESYNENSLKRIDEE 627
gi 16081317 553 EEYRSMH--LEDLRQKYTDWNNAMAVISNIgDIEALRKQKDEVSKKLKDAEDRTHEI--ESEFPDINSYTPSYIGKIEDE 628
gi 48477311 536 NRIKSLKesIEILDSRRTSYLNLLSQRDLI-DIDTNQSRSNEIKSQINDLESGLQEIikIIGFEPDKSYIDK-IREMENE 613
                       650       660       670       680       690       700       710       720
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13541058 628 LNSLRNKKNELYAKKAAMDEIQKTIEHFKEEISKKKGIEDSQAEVNAQLLQINDDLKQLSSRLDKINVDQYEWKSLHKVL 707
gi 16081317 629 VRLLEPQIKLAEDLKRQRETLREKVKDLRSRSAGMDEIQKRKNELSVKASESETRLKYVEGQIQATLSSLSGKRSKVETL 708
gi 48477311 614 ANNYNNKYNEIQENKILIEKLRGKIDNYKKQIAEIDSRIPDLKTITSRINDIEDNYNKSRKALDDAKANRARLEATIEIN 693
                       730       740       750       760       770       780       790       800
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13541058 708 LQDNEKLNIAVADIRKRLEKKETIIKAIADLKRVREAFSKDGVPAIIRKSASEFITNQTRQYIQRFELDIDDVDVDQDFN 787
gi 16081317 709 RSHVSEIEQRISDRERDIERMKKIEKAINDVKRIREAFGKNGVPAMIRQSVSDYLTAKTRDYLSSFDLDFDDISVDQDFN 788
gi 48477311 694 RTRINELSDRINEINETLESMKKIKAAIGFLDELRNALDVSGIQSMIRKEASQAMTSLVRKYLFEFNFDFDDIDIDEDFN 773
                       810       820       830       840       850       860       870       880
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13541058 788 ITVFRGGIAEGIDSLSGGERMAVAFALRVAIAQFLNKDVSLLVMDEPTAFLDEDRRSDLANIIEYSLKDSSGIPQVIMIS 867
gi 16081317 789 VTVYRGGVPEGIDSLSGGEKTAVAFAIRVAVAQFLNADLSLLILDEPTAFLDEERRNSLSDIIEYTLKDSSVIPQVIIIS 868
gi 48477311 774 IKVSQRSMVQDIDSLSGGEKTALSLALRLAVAEYALNNKSFIIMDEPTNYLDEDRRTNLKDIIQYSLRQSGDIDQLIMIT 853
                       890       900
                ....*....|....*....|....*...
gi 13541058 868 HHRELLSASDLALEVKKRNGSSIVDVIR 895
gi 16081317 869 HHRELLASANVAIEVKKIGGRSVVSNAD 896
gi 48477311 854 HHSDMSSVADVSYEIDKSSGSSKIIPL- 880
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap