Conserved Protein Domain Family
PRK01172

?
PRK01172: PRK01172 
ski2-like helicase; Provisional
Statistics
?
PSSM-Id: 100801
View PSSM: PRK01172
Aligned: 3 rows
Threshold Bit Score: 1161.57
Threshold Setting Gi: 48478452
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16081891   1 MKISELGYDRAFLQLFDGNDFQLYDHQRMAIEQIRKGRNVVVSVPTAAGKTLIAYSAIYETFQRNLKSIYIVPLRSLAME 80
gi 13541645   1 MKISDLGYDESFLDLFEGNDFELYDHQRMAIEQFRKGKNIMVSVPTAAGKTLIAYSAIYETFKKKLKSIYIVPLRSLAME 80
gi 48478452   1 MKVSDV-FPDEFLNI-TGSDFELYKHQIDAIERLKNNENVIVSVPTASGKSLIGYYAIYKAFLAGKKSMYIVPLRSLAME 78
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16081891  81 KFSELSRLRDLGLKVKMSIGDYDDSPDFIKRYDAVILTSEKADSLLHHDPYILNDVGLLVLDEIHTIGDESRGPTLETVA 160
gi 13541645  81 KYEELSRLRELGMRVKLSIGNYDDTPDFIKRYDVVILTSEKADSLMHHDPYMMEEVGLMVIDEIHMIGDEYRGPTLETVI 160
gi 48478452  79 KYEELLNLRSLNMRITISIGDYDSPPSFIKNNDVIVVTSERADSMIHHDPDIINDFGAIIADEIHIINDEDRGPRLETVL 158
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16081891 161 SIARYVNPDVRILALSATVSNAMELASWLDASLIKSDFRPVPLKTGILYRDQLYLDGKRR--SGVSINQIIRETVEDNGQ 238
gi 13541645 161 TTARYVNPETRIIALSATVSNASEIAEWLNASLIKSSFRPVPLKVGILYRNRLFLDGDAR--SDVDINLLVKETVDDGGQ 238
gi 48478452 159 SSIRVINPDALILGLSATISNVNELAQWLNASTVVSNFRAVPLELGIIYKKRLITDSYERylGQLDELSLIKDIINDGGQ 238
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16081891 239 VLMFVSSRKKAEDTARDLAQIFGSDANIKISSDETNVYDDMLNEILPRGVAFHHAGLSNDQRAFIEREFRARRIKVIVAT 318
gi 13541645 239 VLIFVSSRKRAEDMAKNLSQLFDPINDLKVSSEDANVYDDLLNEMLPHGVSFHHAGLSNEQRSFIEKAFRHRKLKVIVAT 318
gi 48478452 239 ALVFRNSRKNAEKYAEMLIQHLPEFNDF-----NNDGMPESLVKMIRHGIAYHHAGLSNEDRRNIEEMFKNGYIKVISAT 313
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16081891 319 PTLAAGVNLPARLVIVRDITRWGSDGISYLTNMEIKQMIGRAGRPGYDQYGIGLIYVSSQSSYEAAKDYLSTDPEPVVSY 398
gi 13541645 319 PTLAAGVNLPARLVIVKDVTRYGDLGITYLSNMEVKQMIGRAGRPGYDQYGIGIIYAASANSYQVVKEYISEEPEPVDSY 398
gi 48478452 314 PTLAAGVNLPARLVIIRDITRYSNGYSRPISNIEIQQMLGRAGRPKYDKMGYGYIYAASPASYDAAKKALSGEPEPVISK 393
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16081891 399 LGNEAKVRFNTLAAISMGLARSPSDIMKFYETTLFFSQNGKDLLEEKISASLKFLEKNGFIKQSPDLRTTQLGKVTSDLY 478
gi 13541645 399 IGKPEKVRFNTLAAIAMGLATSQVEMEEFYRSTFYYAQNGEDEIPNRINESIKFLKENGFIKEKDSLRATEFGKMISNLY 478
gi 48478452 394 MDSQRLMRFNILALISSGMASRMEDLILFYNETLMAIQKDVD--DYYIESALYFLKENGFIDGDVTYNATRLGRLTSDLY 471
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16081891 479 IDPESALRLVDFFDGPADVDHAIYYISLCREI--VPFNIKDDYSAMEFLDDIGLID---GDIDAAKTAIVLRDWISEASY 553
gi 13541645 479 IDPESAIILKKYFDDNDDIDTALYYISLCREI--APINMQDDYAAMEFLESIGHID---GDIEAAKTALVLREWISEAST 553
gi 48478452 472 IDPETALILKSALDHDYDEKLYLYYICRTPDMinIPAGTREYEYIEDFLEDINVFDfseESLSAAKTAMVLLGWINEMPM 551
                       570       580       590       600       610       620       630       640
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16081891 554 KYLYDKYGIAPGDMQARISMADWLSYSLAKLSSIYKPEVRRMLEILNLRIKEGIREDILQLVLIPGVGRVRARRLYDAGL 633
gi 13541645 554 RRIFEMYGVAPGDLQARVNNADWISYSLAHLASIFKPERRRKLEILNMRIKEGIREELMDLVLIPAIGRVRARRLYEAGI 633
gi 48478452 552 QKITDTYNIGPGDVQQKASSADWISYSLYRLSSVYKKEMESKLFHLNIRIKEGIKPDLIDLIKIPKVGRVRARRLYDNGF 631
                       650       660       670       680
                ....*....|....*....|....*....|....*....|.
gi 16081891 634 RSIEDVASASPDRIKAIYGFSDTLANAIIRRARTIASKEVR 674
gi 13541645 634 HNVQELAFSDPSRIKMLYGFSDTLANAVVKRAKAIVSERIR 674
gi 48478452 632 KTVDDIARSSPENIEKIFGFSKNLAAEIVNSAMKISSMYYR 672
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap