Conserved Protein Domain Family
PRK01189

?
PRK01189: PRK01189 
V-type ATP synthase subunit F; Provisional
Statistics
?
PSSM-Id: 100807
View PSSM: PRK01189
Aligned: 3 rows
Threshold Bit Score: 151.146
Threshold Setting Gi: 48477563
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16081189   1 MESCITVIGERDVVLGFRLLGIQHTIIAEGKDLLKKFLEVFQNPQCNIIIVSENVKNMMDKRTLRSVEISSKPLVVFIPL 80
gi 13540882   1 MQSCITVIGERDVVLGFRLLGITNTIVAEGKDLVKKFMEEFENPHCSVIVVSEHLKNMIDKKTLRSIEVSSKPLVVFIPL 80
gi 48477563   1 -MNNICVIGERELITGFKLIGIGDAFEFKDKN---DVLRIFNAKKYKYIFLSQSTERYFNENELNILKSSIDPLVIFVPM 76
                        90       100
                ....*....|....*....|....
gi 16081189  81 PGVREEETIEEMAKRILGIDIGNV 104
gi 13540882  81 PGFKEEESIETMAKRILGIDIGSV 104
gi 48477563  77 PGISEEESVFELAKRILGIDIGD- 99
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap