Conserved Protein Domain Family
PRK01194

?
PRK01194: PRK01194 
V-type ATP synthase subunit E; Provisional
Statistics
?
PSSM-Id: 100810
View PSSM: PRK01194
Aligned: 3 rows
Threshold Bit Score: 209.01
Threshold Setting Gi: 48477565
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16081187   1 MSLEEVLKDIERDKEEKKKEIADAASRETAKIEKEREEKIQILQREYENRMREEGSRLYNSIIDKANVEARNIVRMRVQE 80
gi 13540880   1 MSLEQVIKEIEQSQEIKKKEILENTKNILDKMEAEKKAKIDEIRALYQEKMRAESSRITASIIDKANIEARSILRNKIEE 80
gi 48477565   1 MSLADIIKDIDKSREEQISKINDEYSKRIEELKKSCDSRIQSIKEYYEKKKEADIKTLKKVQEDKIKIDSKSIKMEKRRE 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16081187  81 ILDQYGAKADELIKNLAKTKEYDDVLKKMIEVSRKALGPDCIVKVNTADKGRISDGNIKFEDIDPYGGVLATSRDGKIEL 160
gi 13540880  81 ILEGYVSAAQEILRNIRNMPEYPALLNKMIEVAKKYLGQDCIIKVDSKDKAVAPSSGITYSNIDPYGGILASSRDGKVEL 160
gi 48477565  81 IVKDALDISYYHLMNITKSKRYDSILNSMVSTAIKTLGEDCEIFASESDAKKINNAK---ADHKINGGIIAYSKDKKRML 157
                       170       180
                ....*....|....*....|....*
gi 16081187 161 DLRISSIRRDILERFKVRLYSMIED 185
gi 13540880 161 DLRVSSIMEEVLEKIKVKIYTRLEE 185
gi 48477565 158 DFRLNSIFENIKDDLASYFYENIEE 182
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap