Conserved Protein Domain Family
PRK01207

?
PRK01207: PRK01207 
methionine synthase; Provisional
Statistics
?
PSSM-Id: 100814
View PSSM: PRK01207
Aligned: 3 rows
Threshold Bit Score: 670.86
Threshold Setting Gi: 48477258
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
16082016   1 MTALITQEIGSFRKPDYLAKEFHKIERTPKFTELAERATRETLEVFERSGLDNIGIGGEMFRWEMYEHPAERIKGIIFYG 80 
13541954   1 MAALITQEIGSFRKPEYLSMEFHKIEGTEKFKELAERATIDTLKIFENTGLDNVGIGGEMYRWEMYEHPAERIKGLIFYG 80 
48477258   1 --MLITQEIGSFRKPEYLSRVFHKIYGTDEFYRLAEKATLETLDVFYNAGLENIGVGGEMFRWEMYEHQAINIDGIEFYG 78 
16082016  81 MVRSFDNRYYRKGSAIDRLERREPFHVDEVKFVAGTTKKPLKVPITGPYTMMEWSFNDYYDSREDLAMEFARIINEELKD 160
13541954  81 MVRSFDNRYYRKGSVIDKIERRGSFHMDEVEFVAKSTKKPIKIPITGPYTMMDWSFNDHYNDRHELAMEFARIINEELKE 160
48477258  79 PVRSFDNRYYRKGSIVKRMERKSSYHLKELEFLMDNARGSIKVPVTGAYTMMDWSFNEFYRDRYDVAMEFARLLNDEIKD 158
16082016 161 IASVWKQVSGGRRLEIQIDEPATTTHPDEMDIVVDSINRSVQGVDG-EISMHVCYSSDYRLLYDRIPDLKIDGYNLEYSN 239
13541954 161 IQSKWPYISNGRKLEIQIDEPATTTHPDEMDIVVDSVNKSIEGIDA-ELSLHVCYSRDYRLLYDRIPELNIDGYNLEYSN 239
48477258 159 LKSAWDRKFPGKKLEIQIDEPATTTHPDEMDIVKDSINKTVYGIDNcEFSIHVCYSSDYRLLYDIMDEINIDGYNLEFAN 238
16082016 240 RDTLERGLTDDKRVGFQDLKYFAQINESLQRKKFIGIGVTDVHIDYVEPVELIEDRINYALKIIGDPDLVRINPDCGLRT 319
13541954 240 RDTTDLGVEDAKRPGFQDIKYFNEVNESLQRKKFIGVGVTDVHIDFIEPVKLIEDRIKYVLNIIKDPELVKLNPDCGLRT 319
48477258 239 RDTLEPGTSDENRPGYLDLKYFAEHSSG---KKFMGLGVTDVHIDYVEPVKLIEDRIRFALKYI-DPEKLRLNPDCGLRT 314
16082016 320 RSREIGEQKLRNMVMARNNILKQL 343
13541954 320 RSRSIGEQKLRNMVIAKNNVLKDI 343
48477258 315 RSREIGFQKLSNMVAAKKNILKEL 338
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap