Conserved Protein Domain Family
atpC

?
PRK01474: atpC 
F0F1 ATP synthase subunit epsilon; Validated
Statistics
?
PSSM-Id: 100879
View PSSM: PRK01474
Aligned: 13 rows
Threshold Bit Score: 177.372
Threshold Setting Gi: 91204912
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15893157    1 MNATILVKIITPLSIALEKQAKMVTMSGEEGMFGVLPSHVPMIVSLKAGLVQVYIDDMHKSENTYLISGGVTEVTANYIN 80
gi 15604632    1 MHETIRVKIITPSSIAFEKQSKMVTMPGEDGMFGVLPHHVPMIVNLKAGLVQIYIYNIHNYENTYLISGGVTEITSHYIN 80
gi 157829066   1 MNATILVKIITPLSIALEKQAKIVTMSGEEGMFGVLPSHVPMIVSLKAGLVQVYIDDMHKSENTYLISGGVTEVTANYIN 80
gi 165933792   1 MNATILVKIITPLSIALEKQAKIVTMSGEEGMFGVLPSHVPMIVSLKAGLVQVYIDDMHKSENTYLISGGVTEVTANYIN 80
gi 161610763   1 MNETIQVKIITPSSIAFEKQSKMVTMPGEDGMFGVLPNHVPMIVNLTAGLVQVYINNMHNSENTYLISGGVTEITSNYIN 80
gi 157826256   1 MNETILVKIITPLSIALERQAKMVTIPGEDGMFGVLSNHATMIVSLKAGLVQVYIDDIYNPQITYLVSSGVTEVTGSYVN 80
gi 157804172   1 MNETIIVKIITPLSIAFEKQAKMVTLPGDDGMFGVLPSHTPMLVSLKTGLVQVYIDDMHKPKNTYLISGGVTEVAGSYIN 80
gi 91204912    1 MSETINVKIITPLNIVFEEQAKMITLPGEEGEFGVLQGHAPMIVSLKAGLLKVYIDDMHKPKITYLIANGVTEVTGSYIN 80
gi 157827762   1 MSETINVKIITPLNIVFEEQAKMITLPGEEGEFGVLQGHAPMIVSLKAGLLKVYIDDMHKPKITYLIANGVTEVTGSYIN 80
gi 229587162   1 MNATILVKIITPLSIALEKQAKMVTMSGEEGMFGVLPSHVPMIVSLKAGLVQVYIDDMHKSENTYLISSGVTEVTANYIN 80
gi 157964948   7 MNATILVKIITPLSIAFEKQAKMVTMPGEEGMFGVLPSHVLMIVSLKAGLVQVYIDDMHESENTYLISGGVTKVTANYIN 86
gi 67459657    1 MNETILVKIITPLSIAFEKQAKMVTMPGEEGMFGVLPNHAPMIVSLKAGLVQVYIDDIYNPQITYLVSSGVTEVTGSYVN 80
gi 238650820   1 MNATILVKIITPLSIALEKQAKMVTMSGEEGMFGVLPSHVPMIVSLKAGLVQVYIDDMHKSENTYLISGGVTEVTANYIN 80
                         90       100       110
                 ....*....|....*....|....*....|..
gi 15893157   81 IATETAINVTNLSEVEIATKLLDLQKTLSDQH 112
gi 15604632   81 IVTEVAINVTNLSESEISTQRYELQKLLSHQH 112
gi 157829066  81 IATETAINVTNLSEAEIATKLLDLQKTLSDQH 112
gi 165933792  81 IATETAINVTNLSEAEIATKLLDLQKTLSDQH 112
gi 161610763  81 IVTEAAINVTNLSESEISTQCYELQKLSSH-- 110
gi 157826256  81 IATETAINVTNLSEAEIATKLQGLQKPLSEQH 112
gi 157804172  81 IATEIAINVTNLSEAEIATKLLDL-------- 104
gi 91204912   81 IATETAINITDLSEAEIENKLTALQKSI---- 108
gi 157827762  81 IATETAINITDLSEAEIENKLTALQKSI---- 108
gi 229587162  81 IATETAINVTNFSEAEIATKLLDLQKTLSDQH 112
gi 157964948  87 IATETAINVTNLSEAEIATKLLDL-------- 110
gi 67459657   81 IATETAINVTNLNEAEIATKLLELQKPLSEQH 112
gi 238650820  81 IATDTAINVTNLSEAEIATKLLDLQKTLSDQH 112
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap