Conserved Protein Domain Family
fliE

?
PRK01482: fliE 
flagellar hook-basal body protein FliE; Reviewed
Statistics
?
PSSM-Id: 134562
View PSSM: PRK01482
Aligned: 11 rows
Threshold Bit Score: 126.074
Threshold Setting Gi: 42526723
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 42526723    1 MVNAVNVANVNSVpglldvpKINAVVTDnfrakmVSNTDMIELAANKEAASFEQTILKAFDSMNAKQTNMDKLGEQMIVD 80
gi 15594637    4 TDAFFTENNINLV-------KKNPLHFD------VNLFSSKSNAKDNDIKTFKDVLINSITDVNKSQLNVSKVTEQAILK 70
gi 218249375   4 TDAFFTENNINLV-------KKNPLHFD------VNLFSSKSNAKDNDIKTFKDVLINSITDVNKSQLNVSKVTEQAILK 70
gi 187918166   3 VDSFFTDNDVYLI-------RKNPLHFG-------RSSSGFDVKREEKDKTFKDLFFNLMSDVNNSQLDVSKMSQQAILK 68
gi 119953091   3 VDSFFTDNNVYLV-------RKNPLHFD-------KSFSVFDVKREVKAESFKDLFLNLISDVNNSQLDVSRMSQQAILQ 68
gi 111115117   4 IDAFFTENNINLV-------KKNPLHFD------VNLFSSKNTAKNNDIKTFKDVLINTITDVNKSQLNVPKVMEQAIFR 70
gi 203284213   3 VDSFFTDSNVYLI-------RKNPLHFD-------KSFSDFSVKSEKQAGTFRELFLNLISNVNNSQLDMYKVSQQAILH 68
gi 203287752   3 VDSFFTDSNVYLI-------RKNPLHFD-------KSFSDFSVKSEKQAGTFRELFLNLISNVNNSQLDMYKVSQQAILH 68
gi 51598552    4 IDAFFTENNINLI-------KKNPLHLD------VNFFSSKSSTKNNDAKTFKDVLINTITDINKSQLNVSKVMEQVVLS 70
gi 15639389    4 VGTITNSANVYKVpslrkvpEIGPVSVEsvrqrmRGNTDAVDQAVNKKAMSFEQTLLRAFDQVNQKQQKTAELTEQMIVD 83
gi 189025631   4 VGTITNSANVYKVpslrkvpEIGPVSVEsvrqrmRGNTDAVDQAVNKKAMSFEQTLLRAFDQVNQKQQKTAELTEQMIVD 83
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|.
gi 42526723   81 PESVDVHDITMGMAEASLSLKLAQTIIDRLVKTWNDITTTR 121
gi 15594637   71 PSSIDVHDVVIAMSKANMNLSILKAVVERGVKAYQDIINIR 111
gi 218249375  71 PSSIDVHDVVIAMSKANMNLSILKAVVERGVKAYQDIINIR 111
gi 187918166  69 PNDIDVHDIVISMSKANMNLSITKAIVEKSIKAYQDIINIR 109
gi 119953091  69 PNSVDVHDITIAMAKANMNLSITKAVVERSIKAYQDVINIR 109
gi 111115117  71 PSSIDVHDFVIAMSKANMNLSILKAVVERGVKAYQDIINIR 111
gi 203284213  69 PDSVDVHDVVISMAKANMNLSITKAVVEKSIKAYQDVINIR 109
gi 203287752  69 PDSVDVHDVVISMAKANMNLSITKAVVEKSIKAYQDVINIR 109
gi 51598552   71 PSSVDVHDFAIALSKANMNLSILKAVVERGIKAYQDIINIR 111
gi 15639389   84 PESVDVHDVTVAMAEASMSLKIAQTVIDKVLKSWNDVTTAR 124
gi 189025631  84 PESVDVHDVTVAMAEASMSLKIAQTVIDKVLKSWNDVTTAR 124
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap