Conserved Protein Domain Family
rnpA

?
PRK01492: rnpA 
ribonuclease P; Reviewed
Statistics
?
PSSM-Id: 100883
View PSSM: PRK01492
Aligned: 13 rows
Threshold Bit Score: 155.821
Threshold Setting Gi: 157964752
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15604461    3 LCITSLKNQKEFELINKLGEKFYERYFILVIAKKLPKIFLESKYNTFLGIKVSRKLNKKAVVRNKIKRRIRHLMRIIVND 82
gi 51473789    1 MCITSLKNQKEFELINKLGQKFYERYFILVIAKKLPKIFLESKYNTFLGIKVSRKLNKKAVVRNKIKRRIRHLMRIIVND 80
gi 15892860    1 MSITSLKNQKEFELINKLGKKLHERYFILVIATKLPKIFLESKYNTFLGIKVSRKLNKKAVVRNKIKRRIRHLIRIIVSD 80
gi 67458739    1 MSITSLKNQKEFELINKLGKKFHERYFILVIAKKLPKIFLESKYNTFLGIKVSRKLNKKAVVRNKIKRRIRHLIRIIVSD 80
gi 91205682    1 MFITSLKNQKEFELINKLGKKFHEKYFILVIAKNIPKIFLESKYNIFLGIKVSKKLNKKAVVRNKIKRRIKHLIRLICNN 80
gi 157803528   1 MSITSLKNQKEFELINKLGKKFHERYFILVIAKNLPKIFLETKYNIFLGIKVSKKLNKKAVVRNKIKRRIRHLIRMNVSD 80
gi 157828791   1 MSITSLKNQKEFELINKLGKKLHERYFILVIATKLPKIFLESKYNTFLGIKVSRKLNKKAVVRNKIKRRIRHLIRIIVSD 80
gi 157964752   3 LSITSLKNQKEFELINKLGKKLHDRYFIVVIAKKLPKIFLESKYNTFLGIKVSRKLNKKAVVRNKIKRRIRHLIRIIVSD 82
gi 157826004   1 MSITSLKNQKEFELINKLGKKFHERYFILVIARNLPTIFLKSQYNTFLGIKVSRKLNKKAVIRNKIKRRIRHLVRIIVSD 80
gi 157826860   1 MFITSLKNQKEFELINKLGKKFHEKYFILVIAKNIPKIFLESKYNIFLGIKVSKKLNKKAVVRNKIKRRIKHLIRLICNN 80
gi 165933519   1 MSITSLKNQKEFELINKLGKKLHERYFILVIATKLPKIFLESKYNTFLGIKVSRKLNKKAVVRNKIKRRIRHLIRIIVSD 80
gi 229586954   1 MSITSLKNQKEFELINKLGKKLHERYFILVIATKLPKIFLESKYNTFLGIKVSRKLNKKAVVRNKIKRRIRHLIRIIVSD 80
gi 238650655   1 MSITSLKNQKEFELINKLGKKLHERYFILVIATKLPKIFLESKYNTFLGIKVSRKLSKKAVVRNKIKRRIRHLIRIIVSD 80
                         90       100       110
                 ....*....|....*....|....*....|....*...
gi 15604461   83 SNFKAIKFAIIIIPKKGFEEINFSHLQYELSKIILRNI 120
gi 51473789   81 SSVKAIKFAIIIIPRKGFEEINFSHLNYELSKIILRNI 118
gi 15892860   81 SSFKAIKFAMIIIPRKGFEEINFSHLNYELSKVILRNI 118
gi 67458739   81 SKLKAIKFAMIIIPRKGFEEINFSHLNCELSKIILRNI 118
gi 91205682   81 SNLK--KLAMIIIPRKGFDTADFSVLNHELSKAILDFY 116
gi 157803528  81 SKLKAIKLAMIIIPRKGFEEINFSHLNDELSNIILKNI 118
gi 157828791  81 SSFKDIKFAMIIIPRKGFEEINFSHLNYELSKLILRNI 118
gi 157964752  83 SSFKAIKFAMIIIPRKGFEEIHFSHLNYELSKVILRNI 120
gi 157826004  81 AKLSAVKFAMIIIPRKGFEEINFSHLNYELSKIVLRNI 118
gi 157826860  81 SNLK--KLAMIIIPRKGFDTADFSVLNHELSKAILDFY 116
gi 165933519  81 SSFKDIKFAMIIIPRKGFEEINFSHLNYELSKLILRNI 118
gi 229586954  81 SSFKAIKFAMIIIPRKGFEEINFSHLNYELSKVILRNI 118
gi 238650655  81 SSFKAIKFAMIIIPRKGFEEINFSHLNYELSKVILRNM 118
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap