Conserved Protein Domain Family
PRK01844

?
PRK01844: PRK01844 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 100947
View PSSM: PRK01844
Aligned: 25 rows
Threshold Bit Score: 60.7993
Threshold Setting Gi: 163941285
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 154686204  1 MTLWVGILVGVVALLIGVALGFFIARKYMMSYLKKNPPINEQMLRMMMMQMGMKPSQKKINQMMKAMNNQAK 72
gi 225865663  1 MPIWLGILVGVVALVAGVALGFFIARKYMMNYLQKNPPINEQMLKMMMMQMGQKPSQKKINQMMSAMNKQQM 72
gi 301055170  1 MPIWLGILVGVVALVAGVALGFFIARKYMMNYLQKNPPINEQMLKMMMMQMGQKPSQKKINQMMSAMNKQQM 72
gi 52080413   1 MDLWVVILVGVLALLAGVALGFFIARKYMMNYLKKNPPINEQMLRMMMMQMGMKPSQKKINQMMKAMENQTK 72
gi 52785792   1 MDLWVVILVGVLALLAGVALGFFIARKYMMNYLKKNPPINEQMLRMMMMQMGMKPSQKKINQMMKAMENQTK 72
gi 296504180  1 MPIWLGILVGVVALVAGVALGFFIARKYMMNYLQKNPPINEQMLKMMMMQMGQKPSQKKINQMMSAMNKQQM 72
gi 163941285  1 MPMWLGILVGVVALVAGVALGFFIARKYMMNYLQKNPPINEQMLKMMMMQMGQKPSQKKINQMMSAMNKQQT 72
gi 305674524  1 MTLWVGILVGVVALLIGVALGFFIARKYMMSYLKKNPPINEQMLRMMMMQMGMKPSQKKINQMMKAMNNQTK 72
gi 16078854   1 MTLWVGILVGVVALLIGVALGFFIARKYMMSYLKKNPPINEQMLRMMMMQMGMKPSQKKINQMMKAMNNQTK 72
gi 49479439   1 MPIWLGILVGVVALVAGVALGFFIARKYMMNYLQKNPPINEQMLKMMMMQMGQKPSQKKINQMMSAMNKQQM 72
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap