Conserved Protein Domain Family
prsA

?
PRK03002: prsA 
peptidylprolyl isomerase; Reviewed
Statistics
?
PSSM-Id: 101162
View PSSM: PRK03002
Aligned: 20 rows
Threshold Bit Score: 445.149
Threshold Setting Gi: 152974691
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30261271    1 MRGKHIFIITALISILMLAACGQKNSSATVATATDSTITKSDFEKQLKDRYGKDMLYEMIAQDVITKKYKVSDDDVDKEV 80
gi 42780354    1 MRGKHIFIITALLSILMLSACGQKNDSDTVATATDSTITKSDFEKQLKDRYGKDMLYEMMAQDVITKKYKVSDDDVDKEL 80
gi 30019316    1 MRGKHIFIITALISILMLSACGQKNGSATVATATDSTITKDNFEKQLKDRYGKDMLYEMMAQDVITKKYKVPDEEVNKEV 80
gi 222094890   1 MRGKHIFIITALLSILMLSACGQKNDSDTVATATDSTITKSDFEKQLKDRYGKDMLYEMMAQDVITKKYKVSDDDVDKEL 80
gi 218896199   1 MRGKQIFIITALISILMLSACGQKNESATVATATDSTVTKDDFEKQLKDRYGKDMLYEMMAQDVITKKYKVSDEEVNKEV 80
gi 218232569   1 MRGKHIFIITALISILMLSACEQKNGSATVATATDSTITKDNFEKQLKDRYGKDMLYEMMAQDVITKKYKVPDEEVNKEV 80
gi 217958742   1 MRGKHIFIITALLSILMLSACGQKNDSDTVATATDSTITKSDFEKQLKDRYGKDMLYEMMAQDVITKKYKVSDDDVDKEL 80
gi 118476746   1 MRGKHIFIITALISILMLAACGQKNSSATVATATDSTITKSDFEKQLKDRYGKDMLYEMIAQDVITKKYKVSDDDVEKEV 80
gi 296501860   1 MRGKHIFIITALISILMLSACGQKNGSATVATATDSTITKDNFEKQLKDRYGKDMLYEMMAQDIITKKYKVPDEEVNKEV 80
gi 49480029    1 MRGKHIFIITALISILMLAACGQKNSSATVATATDSTITKSDFEKQLKDRYGKDMLYEMIAQDVITKKYKVSDDDVDKEV 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30261271   81 QKAKSQYGDQFKNVLKNNGLKDEADFKNQIKFKLSMNKAIKQSVTEKDVKDHYKPEIKASHILVSDENEAKEIKKKLDTG 160
gi 42780354   81 QKAKNQYGDQFKNVLKNNGLKDEADFKNQIKFKLAMNEAIKKSITEKDVKDHYKPEIKASHILVSDENEAKEIKKKLDAG 160
gi 30019316   81 EKVKKQYGDQFKKVLENYGLKDEEDFKNQIKFKLAMNEAIKKSITEKDVKDHYKPEIKASHILVSDENEAKEIKSKLDAG 160
gi 222094890  81 QKAKNQYGDQFKNVLKNNGLKDEADFKNQIKFKLAMNEAIKKSITEKDVKDHYKPEIKASHILVSDENEAKEIKKKLDAG 160
gi 218896199  81 EKVKKQYGDQFKKVLENNGLKDEEDFKNQIKFKLAMNEAIKKSITEKDVKDHYKPEIKASHILVSDENEAKEIKSKLDAG 160
gi 218232569  81 EKVKKQYGDQFKKVLENYGLKDEEDFKNQIKFKLAMNEAIKKSITEKDIKDHYKPEIKASHILVSDENEAKEIKSKLDAG 160
gi 217958742  81 QKAKNQYGDQFKNVLKNNGLKDEADFKNQIKFKLAMNEAIKKSITEKDVKDHYKPEIKASHILVSDENEAKEIKKKLDAG 160
gi 118476746  81 QKVKNQYGDQFTAVLENNRLKDEADFKKQIKFKLAMNEAIKKSVTEKEVKAHYKPEIKASHILVSDENEAKEIKKKLDAG 160
gi 296501860  81 EKVKKQYGDQFKKVLENYGLKDEEDFKNQIKFKLAMNEAIKKSITEKDVKDHYKPEIKASHILVSDENEAKEIKSKLDAG 160
gi 49480029   81 QKAKNQYGDQFKNVLKNNGLKDEADFKNQIKFKLSMNKAIKQSVTEKDVKDHYKPEIKASHILVSDENEAKEIKKKLEAG 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30261271  161 ASFEELAKQESQDLLSKEKGGDLGYFHSGAMTPEFETAAYKLKIGQISDPVQSPNGYHIIKLTGKKDLKPYDEVKNSIRK 240
gi 42780354  161 ASFEELAKQESQDLLSKEKGGDLGYFNSGRMAPEFETAAYKLKVGQISNPVASPNGYHIIKLTDKKALKPYDEVKDSIRK 240
gi 30019316  161 ASFEELAKQESQDLLSKDKGGDLGYFNSGTMAPEFETAAYKLNVGQISNPVKSSNGYHVIKLTDKKALKPYDEVKDSIRK 240
gi 222094890 161 ASFEELAKQESQDLLSKEKGGDLGYFNSGRMAPEFETAAYKLKVGQISNPVASPNGYHIIKLTDKKELKPYDEVKDSIRK 240
gi 218896199 161 ASFEELAKQESQDLLSKDKGGDLGYFNSGTMAPEFETAAYKLNVGQISNPVKSSNGYHVIKLTDKKDLKPYDEVKNSIRK 240
gi 218232569 161 ASFEELAKQESQDLLSKDKGGDLGYFNSGTMAPEFETAAYKLNVGQISNPVKSSNGYHVIKLTDKKDLKPYDEVKNSIRK 240
gi 217958742 161 ASFEELAKQESQDLLSKEKGGDLGYFNSGRMAPEFETAAYKLKVGQISNPVASPNGYHIIKLTDKKALKPYDEVKDSIRK 240
gi 118476746 161 ASFEELAKQESQDLLSKEKGGDLGYFNSGRMAPEFETAAYKLKVGQISNPVKSPNGYHIIKLTDKKELKPYDEVKDSIRK 240
gi 296501860 161 ASFEELAKQESQDLLSKDKGGDLGYFNSGTMAPEFETAAYKLNVGQISNPVKSSNGYHVIKLTDKKDLKPYDEVKNSIRK 240
gi 49480029  161 ASFEELAKQESQDLLSKEKGGDLGYFNSGRMAPEFETAAYKLKIGQISNPVKSPNGYHIIKLTDKKELKPYDEVKDSIRK 240
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*
gi 30261271  241 NLEEERTADPIFGKKLLQSELKKANIKINDSELEDTFTIVSPQGN 285
gi 42780354  241 NLEEERISDPIFGKKLLQKELKKANIKINDSELKDTFTLTREQEN 285
gi 30019316  241 NLEEERTADPVFSKKLLQEELKKANIKINDSDLKDTFTLVSPQGN 285
gi 222094890 241 NLEEERISDPIFGKKLLQNELKKANIKINDSELEDTFALVYEPAN 285
gi 218896199 241 NLEEERTADPVFSKKLLQEELKKANIKINDSDLKDTFTLVSPQGN 285
gi 218232569 241 NLEEERTADPVFSKKLLQEELKKANIKINDSDLKDTFTLVSPQGN 285
gi 217958742 241 NLEEERISDPIFGKKLLQNELKKANIKINDSELKDTFTLVHEQGN 285
gi 118476746 241 NLEEERIADPTFSHKLLQKELKKANIKINDSELEDTFTIVSPQGN 285
gi 296501860 241 NLEEERTADPVFSKKLLQEELKKANIKINDSDLKDTFTLTREQEN 285
gi 49480029  241 NLEEERIADPTFSHKLLQKELKKANIKINDSELEDTFTIVSSQGN 285
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap