Conserved Protein Domain Family
argD

?
PRK04013: argD 
acetylornithine/acetyl-lysine aminotransferase; Provisional
Statistics
?
PSSM-Id: 101376
View PSSM: PRK04013
Aligned: 4 rows
Threshold Bit Score: 707.457
Threshold Setting Gi: 14520659
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18978057   1 MSLYRKRLRLVKGEGIYVWDSQGKKYIDLIAGIGVNVLGHNHPEWVSELQEQLEKLVVAGPMFDHEEKYEMLEELEKFVT 80
gi 14520659   1 MSLYRKRLKIVRGEGIYVWDSEGKRYLDLIAGIGVAILGHNHPKWVEEVGNQLNKLVVAGPMFEHEEKEEMLEELSRWVN 80
gi 14591479   1 MSLYRKRLKIIKGEGIYVWDDQGRRYVDLIAGIGVAILGHNHPEWVEGIREQLNKLVIAGPMFNHEEKEEMLEELSKFVN 80
gi 57640210   1 MPLYRKRLRLVRGEGVYVWDEKGRRYLDLIAGIGVNVLGHAHPEWVLDMSRQLEKIVVAGPMFEHDEREEMLEELSHWVD 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18978057  81 YEYVYIGNSGTEAVEAALKFARLYTGRKEIIAMTNAFHGRTMGALSATWKPKYREDFKPLVPGFKHIPFNDVEAAKEAIT 160
gi 14520659  81 FEYVYMGNSGTEAVEAALKFARLYTGRKEIIAMTNAFHGRTMGALSATWKSKYKKDFEPLVPGFKHIPFNDVEAAKEAIT 160
gi 14591479  81 FEYLYMGNSGTEAVEAALKFARLYTGRKEIIAMVNAFHGRTMGALSATWKPKYKKDFEPLVPGFKHIPFNDVEAAKEAIS 160
gi 57640210  81 YEYVYMGNSGTEAVEAAIKFARLATGRSEIVAMTNAFHGRTLGSLSATWKKKYREGFGPLVPGFKHIPFNNVEAAKEAIT 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18978057 161 TETAAVIFEPIQGEGGVVPANEEFVKTLRDLTEDKGALLIADEVQSGLRTGKFLAIEHYKVEPDIVTMGKGIGNGVPVSL 240
gi 14520659 161 RTTAAVIFEPIQGESGIIPAKEEFVKTLRDLTEDVGALLIADEVQSGLRTGKFLAVEHYKVEPDIVTLGKGIGNGVPVSL 240
gi 14591479 161 KETAAVIVEPIQGESGVIPAKKEFMKALRDLTEDVGALLIVDEVQTGLRTGKFLAVEHYKIEPDIVTMGKGIGNGIPVGL 240
gi 57640210 161 KETAAVIFEPIQGEGGIVPADEEFVKTLRDLTEDVGALLIADEVQSGLRTGKFLAIEHYGVRPDIVTMGKGIGNGFPVSL 240
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18978057 241 TLTNFDVERGKHGSTFGGNPLACKAVAVTLRILRREKLIEKAAEKFIEIKGENVVLTRGKGLMIGIVMKKPVAKVVEELQ 320
gi 14520659 241 TLTNFDVERGKHGSTFGGNPLACKAVAVTLRILRKERLVEKASEKFIKVKGKDVVTTRGRGLMIGIVLKKPVGRYVEELQ 320
gi 14591479 241 TLTNFDVERGKHGSTFGGNPLACKAVAITLRILRKERLIEKAKNKFIQIDADEVVTTRGKGLMIGIVFKTTIGKYVEELQ 320
gi 57640210 241 TLTDLEIPRGKHGSTFGGNPLACRAVATTLRILRRDRLVEKAGEKFMEFSGERVVKTRGRGLMIGIVLRRPAGNYVKALQ 320
                       330       340       350       360
                ....*....|....*....|....*....|....*....|....
gi 18978057 321 NRGYLVHTAGQRVIRLLPPLIISKDEINQAKSAIEGVINDIYGR 364
gi 14520659 321 NEGYLVHTSGQRVIRLLPPLIISKEKMMEVKSAIEGVINGDTEG 364
gi 14591479 321 NRGYLVHTAGQRVMRLLPPLIISKETMQDVKLAIEGVINDLRGG 364
gi 57640210 321 ERGILVNTAGNRVIRLLPPLIIEGDTLEEARKEIEGVLNDIL-- 362
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap