Conserved Protein Domain Family
PRK04654

?
PRK04654: PRK04654 
sec-independent translocase; Provisional
Statistics
?
PSSM-Id: 135173
View PSSM: PRK04654
Aligned: 8 rows
Threshold Bit Score: 228.158
Threshold Setting Gi: 188574638
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 58584030    1 MFDIGVGELTLIAVVALVVLGPERLPKAARFAGLWVRRARMQWDSVKQELERELEAEELKRSLQDVQASLREAEDQLRNK 80
gi 21233514    1 MFDIGFSELALIAVVALVVLGPERLPKAARFAGLWVRRARMQWDSVKQELERELEAEELKRSLQDVQASLREAEGQLRNT 80
gi 66770479    1 MFDIGFSELALIAVVALVVLGPERLPKAARFAGLWVRRARMQWDSVKQELERELEAEELKRSLQDVQASLREAEGQLRNT 80
gi 188993691   1 MFDIGFSELALIAVVALVVLGPERLPKAARFAGLWVRRARMQWDSVKQELERELEAEELKRSLQDVQASLREAEGQLRNT 80
gi 84625808    1 MFDIGVGELTLIAVVALVVLGPERLPKAARFAGLWVRRARMQWDSVKQELERELEAEELKRSLQDVQASLREAEDQLRNK 80
gi 188574638   1 -----------------------------------MRRARMQWDSVKQELERELEAEELKRSLQDVQASLREAEDQLRNK 45
gi 21244934    1 MFDIGVGELTLIAVVALVVLGPERLPKAARFAGLWVRRARMQWDSVKQELERELEAEELKRSLQDVQASLREAEDQLRNK 80
gi 78049876    1 MFDIGVGELTLIAVVALVVLGPERLPKAARFAGLWVRRARMQWDSVKQELERELEAEELKRSLQDVQASLREAEDQLRNT 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 58584030   81 QQQVEQGARA-------LHDDVSRDIDIRSSATPVATPLELahadlsasaHVDAAAGAAAGAGPAPAPAPAPaAPVIAQA 153
gi 21233514   81 QQQVEDGARGlhdqareLHDEVGRDIDIRTSATPLAAPLEL---------QADAPVVLEPGSAQPHTPVPAP-APVVAQA 150
gi 66770479   81 QQQVEDGARGlhdqareLHDEVGRDIDIRTSATPLAAPLEL---------QADAPVVLEPGSAQPHTPVPAP-APVVAQA 150
gi 188993691  81 QQQVEDGARGlhdqareLHDEVGRDIDIRTSATPLAAPLEL---------QADAPVVLEPGSAQPHTPVPAP-APVVAQA 150
gi 84625808   81 QQQVEQGARA-------LHDDVSRDIDIRSSATPVATPLELahadlsasaHVDAAAGAAAGAGPAPAPA----APVIAQA 149
gi 188574638  46 QQQVEQGARA-------LHDDVSRDIDIRSSATPVATPLELahadlsasaHVDAAAGAAAGAGPAPAPAPA--APVIAQA 116
gi 21244934   81 QQQVEQGARA-------LHDDVSRDIDIRASATPVATPLELahadwsaspDVDTAAGATDAAGAAHT------APVIAQA 147
gi 78049876   81 QQQVEQGART-------LHDDVSRDIDIRASATPVATPLELahadlsaspDVDATAGVTDAAGAAHT------APVIAQA 147
                        170       180       190       200       210       220
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 58584030  154 QPIAPAPHQTLVPAPHDTIVPAPHAAHLTSAPAPPVTVAPvdagtsasptpseptkiQEKQP 215
gi 21233514  151 QPMAPAPKQTLVPAPHGSLTSTQVTTHAPTASATASSTSP-----------------QEKTP 195
gi 66770479  151 QPMAPAPKQTLVPAPHGSLTSTQVTTHAPTASATASSTSP-----------------QEKTP 195
gi 188993691 151 QPMAPAPKQTLVPAPHGSLTSTPVTTHAPTASVTASSTSP-----------------QEKTP 195
gi 84625808  150 QPIAPAPHQTLVPAPHDTIVPAPHAAHLTSAPAPPVTVAPvdagtsasptpseptkiQEKQP 211
gi 188574638 117 QPIAPAPHQTLVPAPHDTIVPAPHAAHLSSAPAPPVTVAPvdagtsasptpseptkiQEKQP 178
gi 21244934  148 QPIAPAPHQTLVPAPHDAIVPAPHAAHLASAP-EPVAVVPvdagtpaasmpsapakiQEKQP 208
gi 78049876  148 QPIAPAPHQTLVPAPHDTIVPAPHAAHLASAP-EPVAVAPvdagtpaawtpsapaklQEKQP 208
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap