Conserved Protein Domain Family
PRK05529

?
PRK05529: PRK05529 
cell division protein FtsQ; Provisional
Statistics
?
PSSM-Id: 135428
View PSSM: PRK05529
Aligned: 5 rows
Threshold Bit Score: 304.151
Threshold Setting Gi: 50955147
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50955147   34 LPSNREIGKALRAARKERRLLERaeVRRFTRRSRRRKQLWTAAAavggaLVLGVVLVGFSPLLALKNIEVTGTERLDPQA 113
gi 28493197    1 MTVIDNAYQNFLYCRKQRKDYER--VCKIRTKIIRRFILLACAV-----FLLFCMLSAYSPVMSLRSIRVAGNMQVKTDD 73
gi 28572688    1 MTVVDNAYQNFLYCRKQRKDYER--VCKIRTKIIRRFILLACAV-----FLLFCMLSAYSPVMSLRSIRVAGNMQVKTDD 73
gi 148273038   1 -------------------------MRRFTQRARRRRAGLLGALgavltLAIVVGIAVYSPLLALRTVEVEGADRVSPSS 55
gi 170781770  19 ATGDAEARRQLRRARRERQRYERqeVRRFTQRTRRRRAGLLGALgavltLAIVVGIAVYSPLLALRTVEVEGADRVSPQS 98
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50955147  114 IRQKLGDQLGRPLPLLDQAAISSDLAAFPLIRSYSVESHPPDTIVVRVVERQPIGAIQQGSAFTVVDAAKVPISSTQARP 193
gi 28493197   74 IVAALRGEFNKPLAFVDPETVRKKLAKFKLLKEVTVEAKPPGAILVRVSERVPLAFLERPDGFHVLDEDGVSLKVTQSPP 153
gi 28572688   74 IVAALRGEFNKPLAFVDPETVRKKLAKFKLLKEVTVEAKPPGAILVRVSERVPLAFLERPDGFHVLDEDGVSLKVTQSPP 153
gi 148273038  56 IQAALSDQVGTPLPLVDLDRVGDELRAFPLIRSYSTESRPPSTLVIRIVERTPVAVIQSGAGFDLVDAAGITIERTTARP 135
gi 170781770  99 IQAALSDQVGTPLPLVDLDRVGDELRAFPLIRSYSTESRPPSTLVIRIVERTPVAVIQSGAGFDLVDPAGITIERATARP 178
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50955147  194 EGMPLIAAsgpaADADADSGFAAAAGVLSALPADVRAQVDTITAKTKDDVLFTLRGSGATVVWGSAEDSALKAADLAALL 273
gi 28493197  154 LGMVRIDV----KDGNQEQLVASLGWVIANIPDALKKRVDLISAETPSGINLKLDNSTKTVFWGSFQNSKLKAKVLEKLL 229
gi 28572688  154 LGMVRIDV----KDGNQEQLVASLGWVIANIPDALKKRVDLISAETPSGINLKLDNSTKTVFWGSFQNSKLKAKVLEKLL 229
gi 148273038 136 DGYPLIDLp---SADFSSPRFQAAAAVLVALPADFLPQVDSIQANTTDDVMLTLR-SGKKVLWGSGERSVDKAQVLQALV 211
gi 170781770 179 DGYPLIDLp---SADFSSPRFQAAAAVLVALPADFLPQVDSIQANTTDDVMLTLR-SGKKVLWGSGERSVDKAQVLQALV 254
                        250       260
                 ....*....|....*....|
gi 50955147  274 KSVPGNSRYDVSSPHSVTTG 293
gi 28493197  230 SIPGHYSSFNVSAPEAPAVS 249
gi 28572688  230 SIPGHYSSFNVSAPEAPAVS 249
gi 148273038 212 KARGDVGSYDVSAPDAPVAG 231
gi 170781770 255 KARGDVGSYDVSAPDAPVAG 274
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap