Conserved Protein Domain Family
PRK05569

?
PRK05569: PRK05569 
flavodoxin; Provisional
Statistics
?
PSSM-Id: 135442
View PSSM: PRK05569
Aligned: 8 rows
Threshold Bit Score: 242.432
Threshold Setting Gi: 15895717
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 150019131   1 MKKVSIIYWSCGGNIEALANTMADGAREQGAEVSVKHVADATLEDVLEADSIAFGSPAVDATKIEQEEMKPFLDQLQNYK 80
gi 15895717    1 MKKISIIYSSQSGNVEVLANEIYEGAKEAGADVTIKLVHEASKEDVLSADALAFGSPSKNNNNIDQEDLAPFLKQFELTL 80
gi 18311044    1 MSKVSVIYWSNGGNVEVLANTIADELTDLGAEVLIKHVSNAKVEDVLEADAVALGSPSMDNNRIEQYDMEPFVNQFKLTP 80
gi 110800444   1 MSKVSVIYWSNGGNVEVLANTIADELTDLGAEVLIKHVSNAKVEDVLEADAVALGSPSMDNNRIEQYDMEPFVNQFKLTP 80
gi 110802033   1 MSKVSVIYWSNGGNVEVLANTIADELTDLGAEVLIKHVSNAKVEDVLEADAVALGSPSMDNNRIEQYDMEPFVNQFKLTP 80
gi 28211393    7 VKKISIIYWSAGGNVEVLAEHVSKGAKTAEAEVDIKQVHYAKPDDVLKVDAVAFGSPSMDNNQIDQTEMAPFLENFKNLN 86
gi 187935404   1 MKKVSIIYWSCGGSVEILANMIADSAEESGAKVTLKHVADATINDVLEADSVAFGSPAMDQNNIEEQEMQPFIDSLKGLS 80
gi 188590631   5 MKNVSIIYWSCGGSVEIIANMIADSAEESGAKVTLKHVADATINDVLEADSVAFGSPAMDQDNIEEQEMQPFIDSLKGLS 84
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 150019131  81 dvNINKNCILFATYGWIEDTFMKLWKDEMSSYGFNVIGDLTIKDSPTKTQANIIKQLGKKLVN 143
gi 15895717   81 --NENKPVVLFGSYGWDNGEFMEKFKDLMNDYSFKVIGDIAVNEAPSKEELKKSRELGKLLAK 141
gi 18311044   81 --NNNKKMILFGSYGWDNGEFMVEWVKRMKDYGFDVVGSLAVNESPNDDEINSAKELAKKLIK 141
gi 110800444  81 --NNNKKMILFGSYGWDNGEFMVEWVKRMKDYGFDVVGSLAVNESPNDDEINSAKELAKKLIK 141
gi 110802033  81 --NNNKKMILFGSYGWDNGEFMVEWVKRMKDYGFDVVGSLAVNESPNDDEINSAKELAKKLIK 141
gi 28211393   87 --LENKPVVLFGSYGWDNGEFIEKWETQMKEYGFNVIGKLAVQETPNEKELEEAKKLGQMLVK 147
gi 187935404  81 --IDNKKCILFGSHGWTDDMFMKLWANTMKSYGFNCIGELVVKESPTKENFKNAQLLGKKLAK 141
gi 188590631  85 --IENKKCILFGSHGWTNDMFMKLWTNTMKSYGFNCIGELVVKESPTKENLENAQLLGKKLAK 145
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap