Conserved Protein Domain Family
PRK05640

?
PRK05640: PRK05640 
putative monovalent cation/H+ antiporter subunit B; Reviewed
Statistics
?
PSSM-Id: 101884
View PSSM: PRK05640
Aligned: 3 rows
Threshold Bit Score: 187.722
Threshold Setting Gi: 18977522
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18977522   5 ILEIITGIIAVTLALITVLHKKFLASLISYSLASLLLALLAMTFRAPDVALSLIVVGALVIGLFIFAHEETREEiKIDLK 84
gi 14521410   1 MLGTMLSFMIILLALTVVLHRDFLASLIAYSLVGLSFVMLAVLARAPDVALSAIAVGGIVIGLFIFAYEKVREE-GIELP 79
gi 14590795   1 MLGIILEVVMLTLALIVILHRDFMTSLIVYSLTSLVFILLVLLSYAPDVALSGIVVGGIVTGLFVFGYERAGGEcKVKLP 80
                        90       100       110       120       130       140       150
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 18977522  85 PGIAVIPLLLLLLKTRITPNSLTYEAYLSVWNLGNLVTEILAGWRFYDSVGEALILFSAAVGFSIVVRRVK 155
gi 14521410  80 LGLAVVPLAIALLRLRVSVNPGSYYHYIKAWSIGNLVSEILAGWRLYDSVGEALILFSAALGFSLLIRGKK 150
gi 14590795  81 LGLAVLPLAFALLRVKFKVNLASYEAYVKAWNINNLVSEILAGWRLYDSVGEALILFSAALGFSLLMGGRK 151
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap