Conserved Protein Domain Family
PRK05645

?
PRK05645: PRK05645 
lipid A biosynthesis lauroyl acyltransferase; Provisional
Statistics
?
PSSM-Id: 135493
View PSSM: PRK05645
Aligned: 17 rows
Threshold Bit Score: 585.717
Threshold Setting Gi: 152985637
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116053731   1 MEKFKGALVVGALRLFALLPWRAVQGVGAGIGWLMWKLPNRSREVVRINLSKCFPELSETELEKLVGQSLMDIGRTLTES 80
gi 15595209    1 MEKFKGALVVGALRLFALLPWRAVQGVGAGIGWLMWKLPNRSREVVRINLSKCFPELSETELEKLVGQSLMDIGRTLTES 80
gi 152985637   1 MEKFKGALVVGALRLFALLPWRAVQGVGAGIGWLMWKLPNRSREVVRINLSKCFPELSEAELEKLVGQSLMDIGKTLTES 80
gi 218888757   1 MEKFKGALVVGALRLFALLPWRAVQGVGAGIGWLMWKLPNRSREVVRINLSKCFPELSETELEKLVGQSLMDIGRTLTES 80
gi 229587591   1 MEKFKGALLVGALRLFALLPWRAVQAVGTAIGWIMWKTPNRSRDTVRINLSKCFPDMDPAARERLVGQSLKDIGKSLTES 80
gi 70733529    1 MDKFKGALLVGALRLFALLPWRAVQAVGAAIGWIMWKTPNRSREVVRINLAKCFPQMDPAERERLVGQSLKDIGKSLTES 80
gi 162286125   1 MEAFKGRLVVGFLRLFALLPWRAVQAVGNAIGWLMWKLPNGSRDVVRINLSKCFPELNQAELDRLVGQSLKDIGKTLTES 80
gi 71737788    1 MDKFKGAVMVGALRLFALLPWRAVQWAGTAIGWLMWKLPNRSREVARINLSKCFPELSEPELEKLVGRSLMDIGKTLTES 80
gi 66043285    1 MDKFKGAVMVGALRLFALLPWRAVQWTGTAIGWLMWKLPNRSREVARINLSKCFPELSEPELEKLVGRSLMDIGKTLTES 80
gi 28867422    1 MDKFKGAVMVGALRLFALLPWRAVQWVGTAIGWLMWKLPNRSREVARINLSKCFPELSEPELEKLVGRSLMDIGKTLTES 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116053731  81 ACAWIWPPEKSLRYIREVEGMEVLEEALASGDGLVGITSHLGNWEVLNHFYCSYAKPIIFYRPPKLKAVDELLKKQRVQL 160
gi 15595209   81 ACAWIWPPEKSLRYIREVEGMEVLEEALASGDGLVGITSHLGNWEVLNHFYCSYAKPIIFYRPPKLKAVDELLKKQRVQL 160
gi 152985637  81 ACAWIWPPEKSLKYIREVEGMEVLEEALASGDGLVGITSHLGNWEVLNHFYCSYAKPIIFYRPPKLKAVDELLKKQRVQL 160
gi 218888757  81 ACAWIWPPEKSLRYIREVEGMEVLEEALASGDGLVGITSHLGNWEVLNHFYCSYAKPIIFYRPPKLKAVDELLKKQRVQL 160
gi 229587591  81 ACAWIWPAQRSIDLVREVEGLEVLHEALASGKGVVGITSHLGNWEVLNHFYCSQCKPIIFYRPPKLKAVDELLRKQRVQL 160
gi 70733529   81 ACAWIWPAERSIALVREVEGLEVLKDALASGKGVVGITSHLGNWEVLNHFYCSQCKPIIFYRPPKLKAVDELLRKQRVQL 160
gi 162286125  81 ACAWIWPAQKSLKLIREVEGLEVLQQALASGKGVVGITSHLGNWEVLNHFYCNQCKPIIFYRPPKLKAVDELLQQQRVQM 160
gi 71737788   81 ACAWIWPAQKSINLVREVEGLDVLKDALASGKGVVGITSHLGNWEVLNHFYCSQCKPIIFYRPPKLKAVDDLLRKQRVQL 160
gi 66043285   81 ACAWIWPAQKSIDLVREVEGLDVLKDALASGKGVVGITSHLGNWEVLNHFYCSQCKPIIFYRPPKLKAVDDLLRKQRVQL 160
gi 28867422   81 ACAWIWPAQKSINLVREVEGLEVLKDALASGKGVVGITSHLGNWEVLNHFYCSQCKPIIFYRPPKLKAVDDLLRKQRVQL 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116053731 161 GNRVAPSTPEGILSVIKEVKKGGCVGIPADPEPARTAGLFVPYLGTTALISKFVPQLLSRGKARGVFFHAVRLPDGSGYK 240
gi 15595209  161 GNRVAPSTPEGILSVIKEVKKGGCVGIPADPEPARTAGLFVPYLGTTALISKFVPQLLSRGKARGVFFHAVRLPDGSGYK 240
gi 152985637 161 GNRVAPSTPEGILSVIKEVKRGGCVGIPADPEPARTAGLFVPYLGTTALISKFVPQLLSRGKARGVFFHAVRLPDGSGYK 240
gi 218888757 161 GNRVAPSTPEGILSVIKEVKKGGCVGIPADPEPARTAGLFVPYLGTTALISKFVPQLLSRGKARGVFFHAVRLPDGSGYK 240
gi 229587591 161 GNRVAASTKEGILSVIKEVRKGGQVGIPADPEPAESAGIFVPFFATQALTSKFVPNMLAGHKAVGVFLHALRLPDGSGYK 240
gi 70733529  161 GNRVAASTKEGILSVIKEVRKGGAVGIPADPEPAESAGIFVPFFATQALTSKFVPNMLAGGKAVGVFLHALRLPDGSGYK 240
gi 162286125 161 GNRVAPSTKEGILSVIKEVRKGGAVGIPADPEPSRSAGVFVPFLGTTALTSKFVPGMLTGGKAVGVFLHALRLPDGSGYK 240
gi 71737788  161 GNRVAASTKEGILSVIKEVRKGGSVGIPADPEPAESAGIFVPFCGTQALTSKFVPNMLAGGKAVGVFLHAMRLPDGSGYK 240
gi 66043285  161 GNRVAASTKEGILSVIKEVRKGGSVGIPADPEPAESAGIFVPFCGTMALTSKFVPNMLAGGKAVGVFLHAMRLPDGSGYK 240
gi 28867422  161 GNRVAASTKEGILSVIKEVRKGGSVGIPADPEPAESAGIFVPFCGTQALTSKFVPNMLAGGKAVGVFLHAMRLPDGSGYK 240
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|....*
gi 116053731 241 VILEAAPADMYDKDLEVSVAAMSRELAKYVRAYPSQYMWSMKRFKNRPDGEKKWY 295
gi 15595209  241 VILEAAPADMYDKDLEVSVAAMSRELAKYVRAYPSQYMWSMKRFKNRPDGEKKWY 295
gi 152985637 241 VILEAAPADMYDKDLDVSVAAMSRELAKYVRAYPSQYMWSMKRFKNRPDGEKKWY 295
gi 218888757 241 VILEAAPADMYDKDLEVSVAAMSRELAKYVRAYPSQYMWSMKRFKNRPDGEKKWY 295
gi 229587591 241 VILEAAPEDMYSTDTATSCAAMSKVVERYVGAYPSQYMWSMKRFKKRPPGEERWY 295
gi 70733529  241 VILEAAPEDMYSTDTETSCAAMSKVVERYVGAYPSQYMWSMKRFKKRPPGEARWY 295
gi 162286125 241 VILEAAPEGMYSENVEEGVAAMSEVVSRYVRNYPSQYMWSMKRFKKRPDGEAKWY 295
gi 71737788  241 VVLEAAPEAMYSTDTETSAAAMSKVVEKYVRAYPSQYMWTMKRFKKRPAGEARWY 295
gi 66043285  241 VVLEAAPEAMYSTDTETSAAAMSKVVEKYVRAYPSQYMWTMKRFKKRPPGEARWY 295
gi 28867422  241 VVLEAAPEAMYSTDTQTSAAAMSKVVEKYVRAYPSQYMWTMKRFKKRPPGEARWY 295
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap