Conserved Protein Domain Family
PRK05874

?
PRK05874: PRK05874 
L-fuculose-phosphate aldolase; Validated
Statistics
?
PSSM-Id: 102036
View PSSM: PRK05874
Aligned: 12 rows
Threshold Bit Score: 440.619
Threshold Setting Gi: 41410291
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118463286   1 MKFVDDPEQAVLDAAKDMLRRGLVEGTAGNISARRSDGNIVITPSSVDYRDMQLDDLVLIDPAGSVLQAAQGRSPSTEMQ 80
gi 31791913    1 MNFVDDPESAVLAAAKDMLRRGLVEGTAGNISARRSDGNVVITPSSVDYAEMLLHDLVLVDAGGAVLHAKDGRSPSTELN 80
gi 41410291    1 MKFVDDPEQAVLDAAKDMLRRGLVEGTAGNISARRSDGNIVITPSSVDYRDMQLDDLVLIDPAGSVLQAAQGRSPSTEMQ 80
gi 15840134    1 MNFVDDPESAVLAAAKDMLRRGLVEGTAGNISARRSDGNVVITPSSVDYAEMLLHDLVLVDAGGAVLHAKDGRSPSTELN 80
gi 15607867    1 MNFVDAPESAVLAAAKDMLRRGLVEGTAGNISARRSDGNVVITPSSVDYAEMLLHDLVLVDAGGAVLHAKDGRSPSTELN 80
gi 148821932   1 MNFVDDPESAVLAAAKDMLRRGLVEGTAGNISARRSDGNVVITPSSVDYAEMLLHDLVLVDAGGAVLHAKDGRSPSTELN 80
gi 148660502   1 MNFVDAPESAVLAAAKDMLRRGLVEGTAGNISARRSDGNVVITPSSVDYAEMLLHDLVLVDAGGAVLHAKDGRSPSTELN 80
gi 253797671   1 MNFVDDPESAVLAAAKDMLRRGLVEGTAGNISARRSDGNVVITPSSVDYAEMLLHDLVLVDAGGAVLHAKDGRSPSTELN 80
gi 183981084   1 MKFVDNAQVAVLAAAKDMLRRGLVEGTAGNISARCADGNLVITPSSVDYADMTLDDLVQVDADGTVLHAKAGRAPSTEMH 80
gi 118616601   1 MKFVDNAQVAVLAAAKDMLRRGLVEGTAGNISARCADGNLVITPSSVDYADMTLDDLVQVDADGTVLHAKAGRAPSTEMH 80
gi 121636649   1 MNFVDDPESAVLAAAKDMLRRGLVEGTAGNISARRSDGNVVITPSSVDYAEMLLHDLVLVDAGGAVLHAKDGRSPSTELN 80
gi 224989121   1 MNFVDDPESAVLAAAKDMLRRGLVEGTAGNISARRSDGNVVITPSSVDYAEMLLHDLVLVDAGGAVLHAKDGRSPSTELN 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118463286  81 LHLACFAAFDDIGCVIHSHPVWATMFAIAHQSIPACIDEFAVYCGGDVRCAEYAASGSPDVGANAVKALQGRGAALIANH 160
gi 31791913   81 LHLACYRAFDDIGSVIHSHPVWATMFAVAHEPIPACIDEFAIYCGGDVRCTEYAASGTPEVGRNAVRALEGRAAALIANH 160
gi 41410291   81 LHLACFAAFDDIGCVIHSHPVWATMFAIAHQSIPACIDEFAVYCGGDVRCADYAASGTPDVGANAVKALQGRGAALIANH 160
gi 15840134   81 LHLACYRAFDDIGSVIHSHPVWATMFAVAHEPIPACIDEFAIYCGGDVRCTEYAASGTPEVGRNAVRALEGRAAALIANH 160
gi 15607867   81 LHLACYRAFDDIGSVIHSHPVWATMFAVAHEPIPACIDEFAIYCGGDVRCTEYAASGTPEVGRNAVRALEGRAAALIANH 160
gi 148821932  81 LHLACYRAFDDIGSVIHSHPVWATMFAVAHEPIPACIDEFAIYCGGDVRCTEYAASGTPEVGRNAVRALEGRAAALIANH 160
gi 148660502  81 LHLACYRAFDDIGSVIHSHPVWATMFAVAHEPIPACIDEFAIYCGGDVRCTEYAASGTPEVGRNAVRALEGRAAALIANH 160
gi 253797671  81 LHLACYRAFDDIGSVIHSHPVWATMFAVAHEPIPACIDEFAIYCGGDVRCTEYAASGTPEVGRNAVRALEGRAAALIANH 160
gi 183981084  81 LHLACYQAFDDIGSVIHSHPVWATMFAIAHQPIPACIDEFAVYCGGDVRCAEYAASGTPEVGRNAVAALQGRAAALIANH 160
gi 118616601  81 LHLACYQAFDDIGSVIHSHPVWATMFAIAHQPIPACIDEFAVYCGGDVRCAEYAASGTPEVGRNAVAALQGRAAALIANH 160
gi 121636649  81 LHLACYRAFDDIGSVIHSHPVWATMFAVAHEPIPACIDEFAIYCGGDVRCTEYAASGTPEVGRNAVRALEGRAAALIANH 160
gi 224989121  81 LHLACYRAFDDIGSVIHSHPVWATMFAVAHEPIPACIDEFAIYCGGDVRCTEYAASGTPEVGRNAVRALEGRAAALIANH 160
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|....*..
gi 118463286 161 GLVAVGPRPDKVLHITALVERTAQIVWGARALGGPVPIPEDVNRNFAAVYGYLRANP 217
gi 31791913  161 GLVAVGPRPDQVLRVTALVERTAQIVWGARALGGPVPIPEDVCRNFTGVYGYLRANP 217
gi 41410291  161 GLVAVGPRPDKVLHITALVERTAQIVWGARALGGPVPIPADVNRNFAAVYGYLRANP 217
gi 15840134  161 GLVAVGPRPDQVLRVTALVERTAQIVWGARALGGPVPIPEDVCRNFTGVYGYLRANP 217
gi 15607867  161 GLVAVGPRPDQVLRVTALVERTAQIVWGARALGGPVPIPEDVCRNFTGVYGYLRANP 217
gi 148821932 161 GLVAVGPRPDQVLRVTALVERTAQIVWGARALGGPVPIPEDVCRNFTGVYGYLRANP 217
gi 148660502 161 GLVAVGPRPDQVLRVTALVERTAQIVWGARALGGPVPIPEDVCRNFTGVYGYLRANP 217
gi 253797671 161 GLVAVGPRPDQVLRVTALVERTAQIVWGARALGGPVPIPEDVCRNFTGVYGYLRANP 217
gi 183981084 161 GLVAVGPRPDKVLHVTALVERTAQIVWGARALGGPVPIPEDVNRNFAGVYAYLRANP 217
gi 118616601 161 GLVAVGPRPDKVLHVTALVERTAQIVWGARALGGPVPIPEDVNRNFAGVYAYLRANP 217
gi 121636649 161 GLVAVGPRPDQVLRVTALVERTAQIVWGARALGGPVPIPEDVCRNFTGVYGYLRANP 217
gi 224989121 161 GLVAVGPRPDQVLRVTALVERTAQIVWGARALGGPVPIPEDVCRNFTGVYGYLRANP 217
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap