Conserved Protein Domain Family
PRK05876

?
PRK05876: PRK05876 
short chain dehydrogenase; Provisional
Statistics
?
PSSM-Id: 135637
View PSSM: PRK05876
Aligned: 12 rows
Threshold Bit Score: 511.423
Threshold Setting Gi: 118616193
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118465477   5 LSGFDGRAAVVTGGASGIGLATATEFARRGARLVLSDVDQPALEQAVNGLRGQGFDAHGVVCDVRHLDEMVRLADEAFRL 84
gi 31792039    1 MDGFPGRGAVITGGASGIGLATGTEFARRGARVVLGDVDKPGLRQAVNHLRAEGFDVHGVMCDVRHREEVTHLADEAFRL 80
gi 41406808    5 LSGFDGRAAVVTGGASGIGLATATEFARRGARLVLSDVDQPALEQAVNGLRGQGFDAHGVVCDVRHLDEMVRLADEAFRL 84
gi 15840264    4 VDGFPGRGAVITGGASGIGLATGTEFARRGARVVLGDVDKPGLRQAVNHLRAEGFDVHSVMCDVRHREEVTHLADEAFRL 83
gi 15607991    1 MDGFPGRGAVITGGASGIGLATGTEFARRGARVVLGDVDKPGLRQAVNHLRAEGFDVHSVMCDVRHREEVTHLADEAFRL 80
gi 148822059   1 MDGFPGRGAVITGGASGIGLATGTEFARRGARVVLGDVDKPGLRQAVNHLRAEGFDVHSVMCDVRHREEVTHLADEAFRL 80
gi 148660628   1 MDGFPGRGAVITGGASGIGLATGTEFARRGARVVLGDVDKPGLRQAVNHLRAEGFDVHSVMCDVRHREEVTHLADEAFRL 80
gi 253800127   1 MDGFPGRGAVITGGASGIGLATGTEFARRGARVVLGDVDKPGLRQAVNHLRAEGFDVHSVMCDVRHREEVTHLADEAFRL 80
gi 183984723   1 MDGFAGRGAVITGGASGIGLATATEFARRGAKVVLADIDKPGLERSVEHLRGKGFDAHGVMCDVRHLSEVNHLAAESARL 80
gi 118616193   1 MDGFAGSGAVITGGASGIGLATATEFARRGAKVVLADIDKPGLERSVEHLRGKGFDAHGVMCDVRHLSEVNHLAAESARL 80
gi 121636774   1 MDGFPGRGAVITGGASGIGLATGTEFARRGARVVLGDVDKPGLRQAVNHLRAEGFDVHGVMCDVRHREEVTHLADEAFRL 80
gi 224989245   1 MDGFPGRGAVITGGASGIGLATGTEFARRGARVVLGDVDKPGLRQAVNHLRAEGFDVHGVMCDVRHREEVTHLADEAFRL 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118465477  85 LGGVDVVFSNAGIVVAGPLAQMNHDDWRWVIDIDLWGSIHAVEAFLPRLLEQGTGGHIAFTASFAGLVPNAGLGTYGVAK 164
gi 31792039   81 LGHFDVVFSNAGIVVGGPIVEMTHDDWRWVIDVDLWGSIHTVEAFLPRLLEQGTGGHVVFTASFAGLVPNAGLGAYGVAK 160
gi 41406808   85 LGGVDVVFSNAGIVVAGPLAQMNHDDWRWVIDIDLWGSIHAVEAFLPRLLEQGTGGHIAFTASFAGLVPNAGLGTYGVAK 164
gi 15840264   84 LGHVDVVFSNAGIVVGGPIVEMTHDDWRWVIDVDLWGSIHTVEAFLPRLLEQGTGGHVVFTASFAGLVPNAGLGAYGVAK 163
gi 15607991   81 LGHVDVVFSNAGIVVGGPIVEMTHDDWRWVIDVDLWGSIHTVEAFLPRLLEQGTGGHVVFTASFAGLVPNAGLGAYGVAK 160
gi 148822059  81 LGHVDVVFSNAGIVVGGPIVEMTHDDWRWVIDVDLWGSIHTVEAFLPRLLEQGTGGHVVFTASFAGLVPNAGLGAYGVAK 160
gi 148660628  81 LGHVDVVFSNAGIVVGGPIVEMTHDDWRWVIDVDLWGSIHTVEAFLPRLLEQGTGGHVVFTASFAGLVPNAGLGAYGVAK 160
gi 253800127  81 LGHVDVVFSNAGIVVGGPIVEMTHDDWRWVIDVDLWGSIHTVEAFLPRLLEQGTGGHVVFTASFAGLVPNAGLGAYGVAK 160
gi 183984723  81 LGQIDVVFSNAGIVVAGPIADMTHDDWRWVIDIDLWGSIHTVEAFLPKLLEH--GGHIAFTASFAGLVPNAGLGAYGVAK 158
gi 118616193  81 LGQIDVVFSNAGIVVAGPIADMTHDVWRWVIDIDLWGSIHTVEAFLPKLLEH--GGHIAFTASFAGLVPNAGLGAYGVAK 158
gi 121636774  81 LGHVDVVFSNAGIVVGGPIVEMTHDDWRWVIDVDLWGSIHTVEAFLPRLLEQGTGGHVVFTASFAGLVPNAGLGAYGVAK 160
gi 224989245  81 LGHVDVVFSNAGIVVGGPIVEMTHDDWRWVIDVDLWGSIHTVEAFLPRLLEQGTGGHVVFTASFAGLVPNAGLGAYGVAK 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118465477 165 YGVVGLAETLAREVKPNGIGVSVLCPMVVETKLVSNSERIRGADYGMSATp--EGAFGPLPTQDESVSADDVARLTADAI 242
gi 31792039  161 YGVVGLAETLAREVTADGIGVSVLCPMVVETNLVANSERIRGAACAQSST---TGSPGPLPLQDDNLGVDDIAQLTADAI 237
gi 41406808  165 YGVVGLAETLAREVKPNGIGVSVLCPMVVETKLVSNSERIRGADYGMSATp--EGAFGPLPTQDESVSADDVARLTADAI 242
gi 15840264  164 YGVVGLAETLAREVTADGIGVSVLCPMVVETNLVANSERIRGAACAQSST---TGSPGPLPLQDDNLGVDDIAQLTADAI 240
gi 15607991  161 YGVVGLAETLAREVTADGIGVSVLCPMVVETNLVANSERIRGAACAQSST---TGSPGPLPLQDDNLGVDDIAQLTADAI 237
gi 148822059 161 YGVVGLAETLAREVTADGIGVSVLCPMVVETNLVANSERIRGAACAQSST---TGSPGPLPLQDDNLGVDDIAQLTADAI 237
gi 148660628 161 YGVVGLAETLAREVTADGIGVSVLCPMVVETNLVANSERIRGAACAQSST---TGSPGPLPLQDDNLGVDDIAQLTADAI 237
gi 253800127 161 YGVVGLAETLAREVTADGIGVSVLCPMVVETNLVANSERIRGAACAQSST---TGSPGPLPLQDDNLGVDDIAQLTADAI 237
gi 183984723 159 YGVVGLAETLSREMKDRGVGVTVLCPMVVETRLVSNSERIRGADYGLSSApqvTGDMGSLPAQDDSLSVDELARLTADAI 238
gi 118616193 159 YGVVGLAETLSREMKDRGVGVTVLCPMVVETQLVSNSERIRGADYGLSSApqvTGDMGSLPAQDDSLSVDELARLTADAI 238
gi 121636774 161 YGVVGLAETLAREVTADGIGVSVLCPMVVETNLVANSERIRGAACAQSST---TGSPGPLPLQDDNLGVDDIAQLTADAI 237
gi 224989245 161 YGVVGLAETLAREVTADGIGVSVLCPMVVETNLVANSERIRGAACAQSST---TGSPGPLPLQDDNLGVDDIAQLTADAI 237
                        250       260       270
                 ....*....|....*....|....*....|....*...
gi 118465477 243 LANRLYILPHAAARESIRRRFERIDRTFDEQAAEGWTH 280
gi 31792039  238 LANRLYVLPHAASRASIRRRFERIDRTFDEQAAEGWRH 275
gi 41406808  243 LANRLYILPHAAARESIRRRFERIDRTFDEQAAEGWTH 280
gi 15840264  241 LANRLYVLPHAASRASIRRRFERIDRTFDEQAAEGWRH 278
gi 15607991  238 LANRLYVLPHAASRASIRRRFERIDRTFDEQAAEGWRH 275
gi 148822059 238 LANRLYVLPHAASRASIRRRFERIDRTFDEQAAEGWRH 275
gi 148660628 238 LANRLYVLPHAASRASIRRRFERIDRTFDEQAAEGWRH 275
gi 253800127 238 LANRLYVLPHAASRASIRRRFERIDRTFDEQAAEGWRH 275
gi 183984723 239 LANRLYVLPHEGARTSIQRRFARIDRTFDEQAAEGWRH 276
gi 118616193 239 LANGLYVLPHEGARTSIQRRFARIDRTFDEQAAEGWRH 276
gi 121636774 238 LANRLYVLPHAASRASIRRRFERIDRTFDEQAAEGWRH 275
gi 224989245 238 LANRLYVLPHAASRASIRRRFERIDRTFDEQAAEGWRH 275
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap