Conserved Protein Domain Family
PRK05884

?
PRK05884: PRK05884 
short chain dehydrogenase; Provisional
Statistics
?
PSSM-Id: 135642
View PSSM: PRK05884
Aligned: 21 rows
Threshold Bit Score: 346.412
Threshold Setting Gi: 169629518
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 108799765   1 MEVLVTGGDTDLGRTIAEGFRDDGHRVVIAGARREDLEINAKELDVDSIVFDNTDPAGVEEARSLFPHHLDTLVNVPAPQ 80
gi 126435406   1 MEVLVTGGDTDLGRTIAEGFRDDGHRVVIAGARREDLEINAKELDVDSIVFDNTDPAGVEEARSLFPHHLDTLVNVPAPQ 80
gi 119868875   1 MEVLVTGGDTDLGRTIAEGFRDDGHRVVIAGARREDLEINAKELDVDSIVFDNTDPAGVEEARSLFPHHLDTLVNVPAPQ 80
gi 118463407   1 MEVLVTGGDTELGRAVAEGFRDDGHKVTLVGARKSDLEIAAKELEAEAIVCDTTDPAALEQARPLFPHHLDTVVHVPAPS 80
gi 221230587   3 VDVLVTGGNTDLGRTIAEGFRNDGHKVTLVGPRRADLEVVAKELDVDTIVCNTTDPASLDEARGLFPRHLNTIVNVPTLG 82
gi 41407662    3 VEVLVTGGDTELGRAVAEGFRDDGHKVTLVGARKSDLEIAAKELEAEAIVCDTTDPAALEQARPLFPHHLDTIVHVPAPS 82
gi 118473731   2 AEVLVTGGDTELGRAIAQGFRDAGHNVVIAGARRDDLEVAAKELDIESIVFDNTDAASLEAVRGQFPHHLDTLVNVPAPR 81
gi 183982736   3 VEVLVTGGDTDLGRTVAEGFRDDGHKVTLVGARRDDLEVVAKELDADAIACDITNPASLAEVRGLFPHHLDTIVNVPAPT 82
gi 145223932   1 MDVLVTGCDTDLGRTIAEGFHEAGHTVLVGGRRRDELEVLAKELDTDAYVFDNTDPASVGDLHGQVPAHLDAIINVPAPT 80
gi 118618414   3 VEVLVTGGDTDLGRTVAEGFRDDGHKVTLVGARRDDLEVVAKELDADAIACDITNPASLAEVRGLFPHHLDTIVNVPAPT 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 108799765  81 YPPADPRTFSLADHALAWRRALDTTVLSAVLTVQIVGDHLRSGGSIVNVIPENvviaqAREGSVDAAIKAALSDWTAGQA 160
gi 126435406  81 YPPADPRTFSLADHALAWRRALDTTVLSAVLTVQIVGDHLRSGGSIVNVIPENvviaqAREGSVDAAIKAALSDWTAGQA 160
gi 119868875  81 YPPADPRTFSLADHALAWRRALDTTVLSAVLTVQIVGDHLRSGGSIVNVIPENvviaqAREGSVDAAIKAALSDWTAGQA 160
gi 118463407  81 WEAGDPRTYSIADTASAWRNALDATVLSAVLTVQTVGDHLRSGGSIISVVPEN-----PPAGSAQAAVKAALSNWTTGQA 155
gi 221230587  83 FDTGDPRTFSLSDTANAWHNELDATVLSAVLTVQSVGDHLRSGGSIIGVLAEN-----PPAGSVDAAIKAALSSWVAGQA 157
gi 41407662   83 WEAGDPRTYSIADTASAWRNALDATVLSAVLTVQTVGDHLRSGGSIISVVPEN-----PPAGSAQAAVKAALSNWTTGQA 157
gi 118473731  82 WEAKDPRTYTLADLASAWRNNLDATVVSAALTVQIVGDHLRSGGSIVNVLPES-----AKEGSVEAAIKAALSDWTAGQA 156
gi 183982736  83 WDAGDPRTYSLADTATAWRNALDTTVLSAVLTVQCVGDHLRSGGSIISVVAEN-----PPAGSVDAAIKGALSNWVAGQA 157
gi 145223932  81 WVGGDPRAYTLTDHAAQWRGLFDANLLASVLTVQVLGDHMRSGGSIITVIPDL-----PEEGGAASAVKAAVSDWTAGLA 155
gi 118618414  83 WDAGDPRTYSLADTATAWRNALDTTALSAVLTVQCVGDHLRSGGSIISVVAEN-----PPAGSVDAAIKGALSNWVAGQA 157
                        170       180       190       200       210       220
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 108799765 161 THFGTRGITVNAVATGKSAGPSYDGLSSTPPAVAAEIARMALFLSTPAARHITGQTMHVSRGALANFG 228
gi 126435406 161 THFGTRGITVNAVATGKSAGPSYDGLSSTPPAVAAEIARMALFLSTPAARHITGQTMHVSRGALANFG 228
gi 119868875 161 THFGTRGITVNAVATGKSAGPSYDGLSSTPPAVAAEIARMALFLSTPAARHITGQTMHVSRGALANFG 228
gi 118463407 156 SVFGTRGITVNAVASGRGAQPGYDGLSRSPAPVAAEVARLALFLTSPAARHITGQTLHVSHGALAHFA 223
gi 221230587 158 GVFGTRGITVNAIACGRSVQAGYEGLSRMPPHVATEITRLALFLTTPASRHITGQTLHVSHGALTHF- 224
gi 41407662  158 SVFGTRGITVNAVASGRGAQPGYDGLSRSPAPVAAEVARLALFLTSPAARHITGQTLHVSHGALAHFA 225
gi 118473731 157 DFFGTRGITINAVAAGRSAEQAYDGLTRTPPSVADEFTRLALFLSTPAARHITGQTLHVSRGALATV- 223
gi 183982736 158 EIYGTRGITVNAVACGRSVQAGYEGLSRTPAPVAAEIARLALFLTTPAARHITGQTLHVSHGALAHFA 225
gi 145223932 156 NHFGIRGITINAVAVGRGVEPGYDGVGATPPPASTEISRLSLFLTTPAARHITGQTLHVSHGALANFA 223
gi 118618414 158 EIYGTRGITVNAVACGRSVQAGYEGLSRTPAPVAAEIARLALFLTTPAARHITGQTLHVSHGALAHFA 225
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap