Conserved Protein Domain Family
dnaE

?
PRK05898: dnaE 
DNA polymerase III DnaE; Validated
Statistics
?
PSSM-Id: 135648
View PSSM: PRK05898
Aligned: 5 rows
Threshold Bit Score: 1374.16
Threshold Setting Gi: 26553651
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13357977     1 MFINLNVHSHYSLLNSTLSIDDLIKYALDNKQPYVCLTDlNNMYGCIEFYDKAKAHNLTPIIGLEFEYQ-----NATLVA 75
gi 26553651    12 LVLNLNTYSHYSLLSSSLSLDQIIEFAINEEKKYVCLTD-TNLYGVIEFYLKCKDKNLMPVIGLSINSQlientKYDFVL 90
gi 31544436     1 MFVNLNTRSYYSLLSTNLSVSEIIDFAVKNNQTHVCLTDlNVLYGAVEFYNLAKKNHLIPIIGLEIFDHs---tNSELVL 77
gi 170762126    1 MFINLNVHSHYSLLNSTLSIDDLIKYALDNKQPYVCLTDlNNMYGCIEFYDKAKAHNLTPIIGLEFEYQ-----NATLVA 75
gi 209554072    1 MFINLNVHSYYSLLNSALSIDDLIQHALDNNQPYVCLTDlNNMYGCIEFYDKAKAHNLIPIIGLEFEYQ-----NTTLVA 75
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13357977    76 YAKNYNGYLKLIKWSSWIMTSKEFEIQDDF-DDLIIVCKKGTIVFKSPNFYQTHDQNAPNAIALQSVFYANKNDKIVFLA 154
gi 26553651    91 FAKNKKGYLNLVKISSFLMTNNDFNYENYL-SDLFIVDKNGTFDFKTDSKVYSINPKDKNAIAFNEARYFNKNDKRVFNA 169
gi 31544436    78 IAKNNSGYLNLIKISSFASSNLEFDLFKYLdENLFVIVKSGDFKWDHVNCLKKKE------LAFNFVNCYDLEKKVGLNV 151
gi 170762126   76 YAKNYNGYLKLIKWSSWIMTSKEFEIQDDF-DDLIIVCKKGTIVFKSPNFYQTHDQNAPNAIALQSVFYANKNDKIVFLA 154
gi 209554072   76 YAKNYNGYLKLIKWSSWIMTNTTFIIQEDF-DDLIIVCKKGGLVFENPNFYQAQNQNASNAIALQSVFYAQENDKTVFLA 154
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13357977   155 MLAI-------KND--LKLEDFKNCCDFDnnhFLNDNLAQSFFSPIALNNLNKVLNELK-VQIHDLPIN-IPVYDKQNSI 223
gi 26553651   170 LQAI-------KNNrtVSIDELEEGQDLS---LLTESESVSLFNDVQIENLNNEIKEVN-LEIEFEKNN-IIKYPNESNL 237
gi 31544436   152 INAVsmkqagkRSK--FQIDELYNSQLVLaspFLSTEKAKKQFSQKQLDRLNDLVQQCSgWDLDNLTKNsIIKYHTPKGF 229
gi 170762126  155 MLAI-------KND--LKLEDFKNCCDFDnnhFLNDNLAQSFFSPIALNNLNKVLNELK-VQIHDLPIN-IPVYDKQNSI 223
gi 209554072  155 MLAI-------KND--LKLDDFIDCHEFDknyFLNDHEAQSLFSTIALDNLNKVLNELQ-VEIHDLPIN-IPVYDKNNLT 223
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13357977   224 ISSEILKQLCISGLKKRL--NANDGQVNKIYVQRLKYELDVINEKQFDDYFLIVYDFINFAKSNGIIVGPGRGSAAGSLV 301
gi 26553651   238 SDKALLHKFCMDGLNEKIfnKEIDSNSKDTYIERMEYELQIIDDMGFNDYFLVVQDFINDAKNKGILIGPGRGSAAGSLI 317
gi 31544436   230 DGDQYLVELCQTRFNDLL----NKRLIRASDQKRLNYELAIIKKLNFSDYFLFVYDFINHAKQQGIVIGPGRGSAAGSFI 305
gi 170762126  224 ISSEILKQLCISGLKKRL--NANDGQVNKIYVQRLKYELDVINEKQFDDYFLIVYDFINFAKSNGIIVGPGRGSAAGSLV 301
gi 209554072  224 VSSEILKQLCISGLKQRL--NAHDGQVKKVYAKRLKYELDVISEKQFDDYFLIVYDFINYAKSNGIIVGPGRGSAAGSLV 301
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13357977   302 AYCLHITDIDPIKHNLIFERFLNPTRKSMPDIDTDIMDEKRDLVIEYLFEKYGNDHVAYILTFQRLKAKMAIRDVGRILG 381
gi 26553651   318 AYLLGITEIDSIKYNLLFERFLNPGRITMPDIDIDIMDIRRDEVVEYLFEKYGYDHVAHIITFQKIKAKMALRDIGRILN 397
gi 31544436   306 SYLLNITTINPISYGLIFERFLNPQRKSMPDIDVDIMDSRREEVVDYLFNKYSKDNVAHIITFQRIKVKNAIRDVCRVLD 385
gi 170762126  302 AYCLHITDIDPIKHNLIFERFLNPTRKSMPDIDTDIMDEKRDLVIEYLFEKYGNDHVAYILTFQRLKAKMAIRDVGRILG 381
gi 209554072  302 AYCLYITDIDPIKHNLIFERFLNPTRKSMPDIDTDIMDEKRDQVIEYLFEKYGNDHVAYIVTFQRLKAKMALRDVGRILG 381
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13357977   382 IDLKVIDKICKNIKPE--------------------YDEDLDLAIKKNTiLKEMYLLHKELFEISKKLINAPRQIGTHAA 441
gi 26553651   398 IDLKIINSICKSITKD--------------------LEEDLANAINTKK-LQDAYKSYKDLFDLAIGIMGCPRQVGIHAA 456
gi 31544436   386 LKTSETDEVINFVSYDeisdweknqnatalkkvlncNECDLDQKKCKRSgAVSCYVISK-IFDLAQTIFNVPRQTGLHAA 464
gi 170762126  382 IDLKVIDKICKNIKPE--------------------YDEDLDLAIKKNTiLKEMYLLHKELFEISKKLINAPRQIGTHAA 441
gi 209554072  382 IDLKVIDKICKNIKTD--------------------YDEDIDLAIKKSAtLKEMYVLHKELFEISKKLIHAPRQIGTHAA 441
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13357977   442 GIILSDSLISNIIPIQLGINDRPLSQYSMEYLERFGLIKMDLLGLKNLTIIDNVLKMIYENQNKKIDLFNINYNDKFVFE 521
gi 26553651   457 GVVLSQKVLTDIVPIQTSVNGEITTQYSMDYLEDLGLIKMDLLGLTNLSTINHVCKLIKMNHGIEINLAKLNLEDQNVFL 536
gi 31544436   465 GVVCGNDALTQTIPLQY-LNNRSVSQFSMEYLEQFGLMKIDLLGLKTLTIIDEINSLVKLNYDRDFDINNIPLNNKNTFN 543
gi 170762126  442 GIILSDSLISNIIPIQLGINDRPLSQYSMEYLERFGLIKMDLLGLKNLTIIDNVLKMIYENQNKKIDLFNINYNDKFVFE 521
gi 209554072  442 GIILSNSSITNIIPIQLGINDRPLSQYSMEYLERFGLIKMDLLGLKNLTIIDNVLKMIYKTQNKKIDLFNIDYNDKFVFQ 521
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13357977   522 DLAKARTNGIFQLESPGMKKVLLKVKPQNIEDISIVSALFRPGPQQNIKTFVERRFKREEFSYWNEATRKILEPTYGIIV 601
gi 26553651   537 DLQQGHTLGIFQLESEGMTSVVKQVKPVCIEDISICSALFRPGPMQNIKPFVRRREGFEKVEYIDVKNKDILEPTHGIIV 616
gi 31544436   544 LLKKGYTKGVFQLESLGMQNVLKKVLPESIEDISIISALYRPGPQDNIDEYVKRRFSNTEFNYLSEDLIEILKPTHGIII 623
gi 170762126  522 DLAKARTNGIFQLESPGMKKVLLKVKPQNIEDISIVSALFRPGPQQNIKTFVERRFKREEFSYWNEATRKILEPTYGIIV 601
gi 209554072  522 DLAKAKTNGIFQLESPGMKKVLLKVKPQNIEDISIVSALFRPGPQQNIKTFVERRFKREEFSYWNEQTKKILEPTYGIII 601
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13357977   602 YQEQVIELVKTIANFDIATSDNFRRAISKKDEKILIQLKDDFINGALNNNYKQPLVNQIFEYIFSFAHYGFNHSHSLAYS 681
gi 26553651   617 YQEQVINLVRRIANFSLSEADMFRRIISKKKGHELDNFKKMFFENALKNDYTQDRLEQIYNYIYTFADYGFNHSHSVAYS 696
gi 31544436   624 YQEQVINTAMVVANFDAAQADSFRRAISKKDEALLLKDKKAFIEQAIKNRYSEQKALEIFEYLHKFADYGFNHSHSLSYA 703
gi 170762126  602 YQEQVIELVKTIANFDIATSDNFRRAISKKDEKILIQLKDDFINGALNNNYKQPLVNQIFEYIFSFAHYGFNHSHSLAYS 681
gi 209554072  602 YQEQVIELVKTIANFDIATSDNFRRAISKKDEKILMQLKDDFINGALANNYKQPLVNQIFEYIFSFAHYGFNHSHSLAYS 681
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13357977   682 YISYWLAYLKHYYTLEFLSVLLSHTSASKDKLLSYLNEAKEFNISIKGPDIQYFSNDFVIdTQKQIIRFGFKTIKGFGDE 761
gi 26553651   697 LIGYWMAYLKHYYPIEFMIILMTFSENDKNKIDLYVNECKRLNINIRKPDINISNKSFGL-YKKNTILFGLNSIKGIGVE 775
gi 31544436   704 FLAYQMAYLKANYPKEFYLILLKNNVDSKVKLTDYFIEIIERNIGIIKPNINLSDWSFSLsADHQKIILGFNMINGLGNE 783
gi 170762126  682 YISYWLAYLKHYYTLEFLSVLLSHTSASKDKLLSYLNEAKEFNISIKGPDIQYFSNDFVIdTQKQIIRFGFKTIKGFGDE 761
gi 209554072  682 YISYWLAYLKHYYPLEFLSVLLSHTSASKEKLLSYLDETKDFNISIKGPDIQHFSNDFVIdNHKQIIRFGFKTIKGFGDE 761
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13357977   762 LLKK---IKSALQKSTLSDYISYIDALKKGNVSLKNIEILIRVGTFDSFGI----------------------------- 809
gi 26553651   776 TSKKiieIRTNNKDKKFSDFCEAIKKLSSNKVGISTLETLINAGTFDGFKL----------------------------- 826
gi 31544436   784 NANK---IVQARNNKQFEGFIDCLINLAKNGITKSLFDKLVNVGVFDQFKLelskkamsalvksyfdqnvgfkndddlis 860
gi 170762126  762 LLKK---IKSALQKSTLSDYISYIDALKKGNVSLKNIEILIRVGTFDSFGI----------------------------- 809
gi 209554072  762 LLKK---IKLALENAELSDYISYIDALKKGNISLKNIEILIRIGAFDSFEI----------------------------- 809
                         890       900       910       920       930       940       950       960
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13357977   810 ----------NRLFLLNNLNEIFEKTGL----NGHFFDLNL------VGLDyAKDMSVNDRYLDDEIQYLGIDLNSlnya 869
gi 26553651   827 ----------SKKYMLENLPIIVDAASNlkddGSFLFEPRL------IDVE-GETNAEKEAFNKKEIELLGLDLNE---- 885
gi 31544436   861 yeekkalvrsSLFFLTKEQPELFLNLSK----DELIAENELadsllkVSFEaIKKKVYKPNIFKKEIAFLEKQIKDlktv 936
gi 170762126  810 ----------NRLFLLNNLNEIFEKTGL----NGHFFDLNL------VGLDyAKDMSVNDRYLDDEIQYLGIDLNSlnya 869
gi 209554072  810 ----------NRLFLLNNLEEIFEKTGL----NGHFFDLNL------VGLDyANDMSINERFQEDEIQYLGINLSSlnyt 869
                         970       980       990      1000      1010      1020      1030      1040
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13357977   870 NYKTEIDYNKLKYTIKDFYEI-----NTNYETNILAQVLNIKQSKTKNGNDIFYLETLIDNKKQTLTIFQNSKYLIDEIS 944
gi 26553651   886 DNNNFSDKNELLYKYPDIKPItepitNGTFKSIVFIKSYEIKKTKKNTDMLSLMLVDIFNNKKKVISFSSHLISNIDSLD 965
gi 31544436   937 KQLKGALQKEVCSILVQIKKVel--kNKIWRFTIFDGAYEI-NAKVRDKKLSDYLTNFINQETKLIVRLDHDLF------ 1007
gi 170762126  870 NYKTEIDYNKLKYTIKDFYEI-----NTNYETNILAQVLNIKQSKTKNGNDIFYLETLIDNKKQTLTIFQNSKYLIDEIS 944
gi 209554072  870 NYTNEIDYSNLKYEIESFNEI-----NTNYEVNIVAQVLNIVQSKTKKGNDIFYLDVLVENKKEKLTIFQNSKHLVDEID 944
                        1050      1060
                  ....*....|....*....|....*
gi 13357977   945 IGGIYV---FGVKLLNHFNFIVNIK 966
gi 26553651   966 FSKKYLgtfRGTTFGPNLTFLDEVE 990
gi 31544436  1008 ---------RGHDSYTILDVVDIFK 1023
gi 170762126  945 IGGIYV---FGVKLLNHFNFIVNIK 966
gi 209554072  945 INGIYV---FGVKLLNHFNFIVSVK 966
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap