Conserved Protein Domain Family
PRK05917

?
PRK05917: PRK05917 
DNA polymerase III subunit delta'; Validated
Statistics
?
PSSM-Id: 102059
View PSSM: PRK05917
Aligned: 14 rows
Threshold Bit Score: 416.504
Threshold Setting Gi: 33241614
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15604907    1 MESAAWEALIQRVRDQKLPSAIILHGQDLSNLSARAYEYASLIIKETLPEAAYKLANKLHPDMHEYSPQGKGRLHTIETP 80
gi 76788909    1 MESAAWEALIQRVRDQKLPSAIILHGQDLSNLSARAYEYASLIIKETLPEAAYKLANKLHPDMHEYSPQGKGRLHTIETP 80
gi 166155272   1 MESAAWEALIQRVRDQKLPSAIILHGQDLSNLSARAYEYASLIIKETLPEAAYKLANKLHPDIHEYSPQGKGRLHTIETP 80
gi 237802611   1 MESAAWEALIQRVRDQKLPSAIILHGQDLSNLSARAYEYASLIIKETLPEAAYKLANKLHPDMHEYSPQGKGRLHTIETP 80
gi 237804533   1 MESAAWEALIQRVRDQKLPSAIILHGQDLSNLSARAYEYASLIIKETLPEAAYKLANKLHPDMHEYSPQGKGRLHTIETP 80
gi 62185124    1 -----------------------MHGSSLSILSQYAYTLASHILLRDTPEAQYKISQKIHPDIQEFLPSGKGRLHSIEIP 57
gi 89898306    7 VINEPWEVLLDSVNQGKIPHAILLHGNSLTMLSQYAYNLAANILVKEFPEAQYKISKKIHPDIHELVPEGKGRLHSIEVP 86
gi 29840269    7 VDNDPWEALLDNINQGKVSHAILLHGNALSLLSQYAYDLAAHILIKDTPEAQYKITQRVHPDIHEFFPSGKGRLHPIEIP 86
gi 16752766    5 EENQGWEALLRKVYHQEVPPAILLHGFTLPVLQDKAEQLASEILLSSSPGSEHKVSQKIHPDIYQFFPEGKGRLHSIDLP 84
gi 15618192    5 EENQGWEALLRKVYHQEVPPAILLHGFTLPVLQDKAEQLASEILLSSSPGSEHKVSQKIHPDIYQFFPEGKGRLHSIDLP 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15604907   81 RAIRKDIWIHPYESPYKIYIIYEADRITLDAISAFLKLLEDPPQYGMFILVSALPQRLPPTIRSRCVSFRIPMEEKTLVS 160
gi 76788909   81 RAIRKDIWIHPYESPYKIYIIYEADRITLDAISAFLKLLEDPPQYGMFILVSALPQRLPPTIRSRCVSFRIPMEEKTLVS 160
gi 166155272  81 RAIRKDIWIHPYESPYKIYIIYEADRITLDAISAFLKLLEDPPQYGMFILVSALPQRLPPTIRSRCVSFHIPMEEKTLVS 160
gi 237802611  81 RAIRKDIWIHPYESPYKIYIIYEADRITLDAISAFLKLLEDPPQYGMFILVSALPQRLPPTIRSRCVSFRIPMEEKTLVS 160
gi 237804533  81 RAIRKDIWIHPYESPYKIYIIYEADRITLDAISAFLKLLEDPPQYGMFILVSALPQRLPPTIRSRCVSFRIPMEEKTLVS 160
gi 62185124   58 RDIKKQIAILPYEGHYKIYIIHEVDRMTLPAISVFLKVLEEAPSHNVILLTSAKLQRIPATILSRSLSIHIQGQDKTLPN 137
gi 89898306   87 RDIKRQIGVLPYEASYKIYIIHEVDRMTLPAISAFLKVLEDAPPHSVIILTSTKLQRIPATILSRSFSLYIQGEEHRDPN 166
gi 29840269   87 RDIKKQIGVLPYEGCYKIYIIHEVDRMTLPAISVFLKVLEDAPAHSVILLTSAKLQRIPATILSRSLSIYIQGKENVAPN 166
gi 16752766   85 RGIKKQIYISPFEANYKIYIIHEADRMTLAAISAFLKVFEEPPKHAVIILTTAKVQRLPKTIISRSLSIFIERGEKILCS 164
gi 15618192   85 RGIKKQIYISPFEANYKIYIIHEADRMTLAAISAFLKVFEEPPKHAVIILTTAKVQRLPKTIISRSLSIFIERGEKILCS 164
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15604907  161 KKDIAFLIGLAQGKESVTRIGSQVKGTADEDKQVLRDKTKAMLTVLLQLFRDRFLLAKKVPVSLLAYPDLLNEIKTMPVY 240
gi 76788909  161 KKDIAFLIGLAQGKESVTRIGSQVKGTADEDKQVLRDKTKAMLTVLLQLFRDRFLLAKKVPVSLLAYPDLLNEIKTMPVY 240
gi 166155272 161 KKDIAFLIGLAQGKESVTRIGSQVKGTADEDKQVLRDKTKAMLTVLLQLFRDRFLLAKKVPVSLLAYPDLLNEIKTMPVY 240
gi 237802611 161 KKDIAFLIGLAQGKESVTRIGSQVKGTADEDKQVLRDKTKAMLTVLLQLFRDRFLLAKKVPVSLLAYPDLLNEIKTMPVY 240
gi 237804533 161 KKDIAFLIGLAQGKESVTRIGSQVKGTADEDKQVLRDKTKAMLTVLLQLFRDRFLLAKKVPVSLLAYPDLLNEIKTMPVY 240
gi 62185124  138 EEEIAYLLKYASGEMSITEVGKIVKGSVDTDKQVLRDKAKYLLEVLLTLFRDRFILSLNVSASAMTYPQYAKGILNLPVL 217
gi 89898306  167 KEDVAYLLKYASGKMKITEAGQIVKGGADADKQMLRDKAKRLLEVLLMLFRDRFMLSLNMSASAMTYPQYAKDILNLPAL 246
gi 29840269  167 EEDIEYLLNYASGKMKITEVGQIVKGNADTDKQVLRDKAKVLLEILLKLFRDRFMLSLNIPASALAYPKYAKDILNLPIL 246
gi 16752766  165 KETFSYLFRYAQCEIPVTEVSQIIKESSETDKQVLRDKVQRFMEVLLELYRDRYTLNLGLKASALNYPEHVKEILQLPLL 244
gi 15618192  165 KETFSYLFRYAQCEIPVTEVSQIIKESSETDKQVLRDKVQRFMEVLLELYRDRYTLNLGLKASALNYPEHVKEILQLPLL 244
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|
gi 15604907  241 PLEEVLSIITRAVQALDSYSSAPSCLEWICLQLWSFKNRQQMAIRNRRRS 290
gi 76788909  241 PLEEVLSIITRAVQALDSYSSAPSCLEWICLQLWSFKNRQQMAIRNRRRS 290
gi 166155272 241 PLEEVLSIITRAVQALDSYSSAPSCLEWICLQLWSFKNRQQMAIRNRRRS 290
gi 237802611 241 PLEEVLSIITRAVQALDSYSSAPSCLEWICLQLWSFKNRQQMAIRNRRRS 290
gi 237804533 241 PLEEVLSIITRAVQALDSYSSAPSCLEWICLQLWSFKNRQQMAIRNRRRS 290
gi 62185124  218 PLEKVLVIIEKAYQALDNSSSATSCMEWVALQLASLNHRSSILTERTCP- 266
gi 89898306  247 PLEKVLIVIEKAYRSLDNSSSATSCMEWVALQLASLSHRSSMLV------ 290
gi 29840269  247 PLEKVLIIIEKAHQALDNSSSATSCMEWVALQLVSLNNRLAR-------- 288
gi 16752766  245 PLDKVLLIVESACRSLNNSSSAASVLEWVAIQLVSLQYKEKELVSVSPGQ 294
gi 15618192  245 PLDKVLLIVESACRSLNNSSSAASVLEWVAIQLVSLQYKEKELVSVSPGQ 294
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap