Conserved Protein Domain Family
PRK05927

?
PRK05927: PRK05927 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 135660
View PSSM: PRK05927
Aligned: 14 rows
Threshold Bit Score: 735.92
Threshold Setting Gi: 15834768
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15605500    1 MGSPARTSFQEGLRLFLYSPLEELRIHADSLRKQRYPQNTITYVLDANPNYTNICKIDCAFCAFYRKPRSSDAYLLSFDE 80
gi 166154109   1 MGSPARTSFQEGLRLFLYSPLEELRIHADSLRKQRYPQNTITYVLDANPNYTNICKIDCAFCAFYRKPRSSDAYLLSFDE 80
gi 166154984   1 MGSPARTSFQEGLRLFLYSPLEELRIHADSLRKQRYPQNTITYVLDANPNYTNICKIDCAFCAFYRKPRSSDAYLLSFDE 80
gi 237803197   1 MGSPARTSFQEGLRLFLYSPLEELRIHADSLRKQRYPQNTITYVLDANPNYTNICKIDCAFCAFYRKPHSSNAYLLSFDE 80
gi 237805118   1 MGSPARTSFQEGLRLFLYSPLEELRIHADSLRKQRYPQNTITYVLDANPNYTNICKIDCAFCAFYRKPHSSNAYLLSFDE 80
gi 62185426    1 MNLFTRISFDEGLELFRTSPLEKLQEAANILRKQRHPGNKVTYVLDANPNYTNICKIDCTFCAFYRKPHASDAYLLSFDK 80
gi 89897966    1 MNLFTRISFDEGLELFRTSPLEKLQEVANILREQRYPDNKVTYVLDANPNYTNICKIDCTFCAFYRKPHSSDAFLLSFDE 80
gi 29840614    1 MNLSTRISFDKGLELFRTSPLEKLQEVANILREQRYPDNKVTYVLDANPNYTNICKIDCTFCAFYRKPRSADAFLLSFDE 80
gi 16752125    1 MNLCKRISFEEGLELFVSSPIERLQERADAIRKERYPSNEVTYVLDANPNYTNICKIDCTFCAFYRKPKSPDAYLLSFDE 80
gi 15618820    1 MNLCKRISFEEGLELFVSSPIERLQERADAIRKERYPSNEVTYVLDANPNYTNICKIDCTFCAFYRKPKSPDAYLLSFDE 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15605500   81 FRQLMQRYVQAGIKTVLLQGGVHPQIGIDYLETLVSITKKEFPSLHPHFFSAVEIAHAAQISGISTEQALERLWEAGQRT 160
gi 166154109  81 FRQLMQRYVQAGIKTVLLQGGVHPQIGIDYLETLVSITKKEFPSLHPHFFSAVEIAHAAQISGISTEQALERLWEAGQRT 160
gi 166154984  81 FRQLMQRYVQAGIKTVLLQGGVHPQIGIDYLETLVSITKKEFPSLHPHFFSAVEIAHAAQISGISTEQALERLWEAGQRT 160
gi 237803197  81 FRQLMQRYVQAGIKTVLLQGGVHPQIGIDYLETLVSITKKEFPSLHPHFFSAVEIAHAAQISGISTEQALERLWEAGQRT 160
gi 237805118  81 FRQLMQRYVQAGIKTVLLQGGVHPQIGIDYLETLVSITKKEFPSLHPHFFSAVEIAHAAQISGISTEQALERLWEAGQRT 160
gi 62185426   81 FRSLMQRYISMGVKTVLLQGGVHPQLGIDYLEEFVRITVQEFPSIHPHFFSAVEISHAASVSGISNEEALMRLWNAGQRT 160
gi 89897966   81 FRSLMQRYIALGVKTVLLQGGVHPSLGMDYLAEFVRITVKEFPSIHPHFFSAVEISHAASVSGISNEKALGMLWDAGQRT 160
gi 29840614   81 FRSLMQRYISMGVKTVLLQGGVHPRLGVDYLEEFVRITVKEFPSLHPHFFSAVEIAHAATVSGVSTEEALGRLWDAGQRT 160
gi 16752125   81 VRSLLQRYVSSGVKTVLLQGGVHPGLGIDYLEELVRITVQEFPSIHPHFFSAVEIEHACRVSGISIEQGLQRLWDAGQRT 160
gi 15618820   81 VRSLLQRYVSSGVKTVLLQGGVHPGLGIDYLEELVRITVQEFPSIHPHFFSAVEIEHACRVSGISIEQGLQRLWDAGQRT 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15605500  161 IPGGGAEILSERIRKQISPKKMGPDGWIQFHKLAHRLGFRSTATMMFGHVESPEDILLHLQTLRDAQDENPGFFSFIPWS 240
gi 166154109 161 IPGGGAEILSERIRKQISPKKMGPDGWIQFHKLAHRLGFRSTATMMFGHVESPEDILLHLQTLRDAQDENPGFFSFIPWS 240
gi 166154984 161 IPGGGAEILSERIRKQISPKKMGPDGWIQFHKLAHRLGFRSTATMMFGHVESPEDILLHLQTLRDAQDENPGFFSFIPWS 240
gi 237803197 161 IPGGGAEILSERIRKQISPKKMGPDGWIQFHKLAHRLGFRSTATMMFGHVESPEDILLHLQTLRDAQDENPGFFSFIPWS 240
gi 237805118 161 IPGGGAEILSERIRKQISPKKMGPDGWIQFHKLAHRLGFRSTATMMFGHVESPEDILLHLQTLRDAQDENPGFFSFIPWS 240
gi 62185426  161 IPGGGAEIFSERVRKIISPKKMGPDGWINFHKLAHRLGFYSTATMMFGHIENAHDILLHLQALRDAQDETPGFYSFIPWS 240
gi 89897966  161 IPGGGAEILSERVRKILSPKKIGPDGWISFHKLAHCLGFRSTATMMFGHVENAHDILLHLEALRNAQDEVPGFYSFIPWS 240
gi 29840614  161 IPGGGAEILSERVRKIVSPKKMGPDGWINFHKLAHRLGFRTTATMMFGHIETAHDILLHLETLRNAQDETPGFYSFIPWS 240
gi 16752125  161 IPGGGAEILSERVRKIISPKKMQPGGWINLHKLAHLMGFRTTATMMFGHVENPEDILIHLQTLRDAQDSCPGFYSFIPWS 240
gi 15618820  161 IPGGGAEILSERVRKIISPKKMQPGGWINLHKLAHLMGFRTTATMMFGHVENPEDILIHLQTLRDAQDSCPGFYSFIPWS 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15605500  241 YKPNNTALGRRVPHQASPELYYRILAVARIFLDNFDHIAASWFGEGKEEGVKGLFYGADDFGGTILDESVHKCTGWDLQS 320
gi 166154109 241 YKPNNTALGRRVPHQASPELYYRILAVARIFLDNFDHIAASWFGEGKEEGVKGLFYGADDFGGTILDESVHKCTGWDLQS 320
gi 166154984 241 YKPNNTALGRRVPHQASPELYYRILAVARIFLDNFDHIAASWFGEGKEEGVKGLFYGADDFGGTILDESVHKCTGWDLQS 320
gi 237803197 241 YKPNNTALGRRVPHQASPELYYRILAVARIFLDNFDHIAASWFGEGKEEGVKGLFYGADDFGGTILDESVHKCTGWDLQS 320
gi 237805118 241 YKPNNTALGRRVPHQASPELYYRILAVARIFLDNFDHIAASWFGEGKEEGVKGLFYGADDFGGTILDESVHKCTGWDLQS 320
gi 62185426  241 YKSGNTALGRKVPNQAPPEMYYRILALARIFLDNFEHIAASWFGEGKEHGARGLHYGADDFGGTIIDESVHKCAGWTLKS 320
gi 89897966  241 YKSGNTALGRKVPHQAPPEMYYRILAVARIFLDNFDHIAASWFGEGKELGARGLHYGADDFGGTIIDESVHRCTGWTLKS 320
gi 29840614  241 YKSGNTALGRKVPNQAAPEMYYRILALSRIFLDNFEHIAASWFGEGKEYGARGLHYGADDFGGIIIDESVHKCTGWTLKS 320
gi 16752125  241 YKPGNTALRRNVPQQASIETYYRILALGRIFLDNFDHVAASWFGEGKSLGAKALHYGADDFGGVILDESVHKATGWSIQS 320
gi 15618820  241 YKPGNTALRRNVPQQASIETYYRILALGRIFLDNFDHVAASWFGEGKSLGAKALHYGADDFGGVILDESVHKATGWSIQS 320
                        330       340       350
                 ....*....|....*....|....*....|
gi 15605500  321 SEKEICAMLLQAGFTPVERDTFYRPLSLAR 350
gi 166154109 321 SEKEICAMLLQAGFTPVERDTFYRPLSLAR 350
gi 166154984 321 SEKEICAMLLQAGFTPVERDTFYRPLSLAR 350
gi 237803197 321 SEKEICAMLLQAGFTPVERDTFYRPLSLAR 350
gi 237805118 321 SEKEICAMLLQAGFTPVERDTFYRPLSLAR 350
gi 62185426  321 SEEETRTMIASEGFIPVERNTFYEPIETPS 350
gi 89897966  321 SEEEARAIIASEGFIPVERNTFYERIETPA 350
gi 29840614  321 SEEEARAMIASEGFIPVERNTFYEHIEIPA 350
gi 16752125  321 SEEEICNIIRSEGFIPVERNTFYQHISCTV 350
gi 15618820  321 SEEEICNIIRSEGFIPVERNTFYQHISCTV 350
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap