Conserved Protein Domain Family
PRK05937

?
PRK05937: PRK05937 
8-amino-7-oxononanoate synthase; Provisional
Statistics
?
PSSM-Id: 102071
View PSSM: PRK05937
Aligned: 14 rows
Threshold Bit Score: 632.587
Threshold Setting Gi: 15834778
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15605510    1 MKEALSIDFITNDFLGFSRSDSLVHAVEARYRLYCRDKPHAQLGYGGSRAILGSSSLLDGVEHQIAHFHGAPEALILPSG 80
gi 76789519    1 MKEALSIDFITNDFLGFSRSDSLVHAVEARYRLYCRDKPHAQLGYGGSRAILGSSSLLDGVEHQIAHFHGAPEALILPSG 80
gi 166154994   1 MKEALSIDFITNDFLGFSRLDSLVHAVEARYRLYCRDKPHAQLGYGGSRAILGSSSLLDGVEHQIAHFHGAPEALILPSG 80
gi 237803207   1 MKEALSIDFITNDFLGFSRSDSLVHAVEARYRLYCRDKPHAQLGYGGSRAILGSSSLLDGVEHQIAHFHGAPEALILPSG 80
gi 237805128   1 MKEALSIDFITNDFLGFSRSDSLVHAVEARYRLYCRDKPHAQLGYGGSRAILGSSSLLDGVEHQIAHFHGAPEALILPSG 80
gi 62185416    1 -MSECPIDFVTNDFLGFSRSTVLVNEVERRYRVYCEQFPHAQLGACGSRAIVGPSQTLQKLETKIAQFHQAEAAFVVHSG 79
gi 89897977    1 -MSECPIDFVTNDFLGFSRSTILVNEVEKRYRAYCEQFSHAQLGASGSRAILGPSQIQQDLEEKIAKFHNSESAFVVHSG 79
gi 29840603    1 -MSEYPIDFVTNDFLGFSRSTTLVKEVEKRYRAYCEEFSHAQLGARGSRAIAGPSQILQNLEKKIVDFHNAEAAFVVHNG 79
gi 16752113    1 MTTSDVIDFVTNDFLGFARSPTIYCEVSKRFQIHCQQFPHEKLGIRGSRLMVGPSSVIDDLESKIASYHGAPNAFIVNSG 80
gi 15618832    1 MTTSDVIDFVTNDFLGFARSPTIYCEVSKRFQIHCQQFPHEKLGIRGSRLMVGPSSVIDDLESKIASYHGAPNAFIVNSG 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15605510   81 FVANTAICAHLSSVADYVLWDEQVHISVSYNLSVfLSGWHQSFRHNDLDHLESLLESCQQRGFQRVFILVCSVYSFKGSF 160
gi 76789519   81 FVANTAICAHLSSVADYVLWDEQVHISVSYNLSVfLSGWHQSFRHNDLDHLESLLESCQQRGFQRVFILVCSVYSFKGSF 160
gi 166154994  81 FVANTAICAHLSSVADYVLWDEQVHISVSYNLSVfLSGWHQSFRHNDLDHLESLLESCQQRGFQRVFILVCSVYSFKGSF 160
gi 237803207  81 FVANTAICAHLSSVADYVLWDEQVHISVSYNLSVfLSGWHQSFRHNDLDHLESLLESCQQRGFQRVFILVCSVYSFKGSF 160
gi 237805128  81 FVANTAICAHLSSVADYVLWDEQVHISVSYNLSVfLSGWHQSFRHNDLDHLESLLESCQQRGFQRVFILVCSVYSFKGSF 160
gi 62185416   80 YMANLGFCYHISKDTDMVFWDASVHISVVQSLKM-ISGKHQSFPHNDLTALESLLMSHRAVSSGRIFIFVCSVYSFLGTL 158
gi 89897977   80 YMANLGLCYHISKNTDIVFWDESVHISVAQSLRV-ISGEHQAFPHNDLCALESLLISHRAVSSGRIFIFVCSVYSFSGTL 158
gi 29840603   80 YMANLGFCYHISKDTDKVFWDESVHVSVVQSLKM-ISGKQQSFPHNDLDALESLLIAHRAVSSGRIFIFVCSVYSFSGTS 158
gi 16752113   81 YMANLGLCHHVSRSTDVLLWDEEVHMSVVHSLSA-ISGQHHTFHHNNLEHLESLLQCYRISSKGRIFIFVSSVYSFRGTL 159
gi 15618832   81 YMANLGLCHHVSRSTDVLLWDEEVHMSVVHSLSA-ISGQHHTFHHNNLEHLESLLQCYRISSKGRIFIFVSSVYSFRGTL 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15605510  161 ALLEQIVALSHQYHAQLIVDEAHAVGLFGDAGKGFCASLGYENFYSVLVTFSKALGSAGAAWLSSRDRKQDLI-KEPMVS 239
gi 76789519  161 ALLEQIVALSHQYHAQLIVDEAHAVGLFGDAGKGFCASLGYENFYSVLVTFSKALGSAGAAWLSSRDRKQDLI-KEPMVS 239
gi 166154994 161 APLEQIVALSHQYHAQLIVDEAHAVGLFGDAGKGFCASLGYENFYSVLVTFSKALGSAGAAWLSSCDRKQDLI-KEPMVS 239
gi 237803207 161 ALLEQIVALSHQYHAQLIVDEAHAVGLFGDAGKGFCASLGYENFYSVLVTFSKALGSAGAAWLSSRDRKQDLI-KEPMVS 239
gi 237805128 161 ALLEQIVALSHQYHAQLIVDEAHAVGLFGDAGKGFCASLGYENFYSVLVTFSKALGSAGAAWLSSRDRKQDLI-KEPMVS 239
gi 62185416  159 APLEELLPLSRKYHAHLIVDEAHAMGIFGEEGRGFCHTWGYENFYAVLVTYSKAMGAMGAAILSSSEVKTELLlNSPPLR 238
gi 89897977  159 APLEELIALSKKYNAHLIVDEAHAMGILGEEGRGLCHKWGYENFYAVLVTYSKAMGAMGAALLSSLEVKTELMlSSPPLR 238
gi 29840603  159 APLEELIDLSRKYHAHIIVDEAHAMGIFGEDGRGLCHQWGYENFYSVLVTYSKAMGAMGAAILCSSEVKTELMlNSPPLR 238
gi 16752113  160 APLEQIIALSKKYHAHLIVDEAHAMGIFGDDGKGLCHALGYENFYAVLVTYGKALGTMGASLLTSSEVKYDLMqNSPPLR 239
gi 15618832  160 APLEQIIALSKKYHAHLIVDEAHAMGIFGDDGKGLCHALGYENFYAVLVTYGKALGTMGASLLTSSEVKYDLMqNSPPLR 239
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15605510  240 LSTGIPPYLLVSIQVAYEFLSQEGELARTRLRRIRDYFAQKISWAAAGFVQPLSLPGISEQELYQKLVATGIRVGVACPP 319
gi 76789519  240 LSTGIPPYLLVSIQVAYEFLSQEGELARTRLRRIRDYFAQKISWAAAGFVQPLSLPGISEQELYQKLVATGIRVGVACPP 319
gi 166154994 240 LSTGIPPYLLVSIQVAYEFLSQEGELARTRLRRIRDYFAQKISWAAAGFVQPLSLPGISEQELYQKLVATGIRVGVACPP 319
gi 237803207 240 LSTGIPPYLLVSIQVAYEFLSQEGELARTRLRRIRDYFAQKISWAAAGFVQPLSLPGISEQELYQKLVATGIRVGVACPP 319
gi 237805128 240 LSTGIPPYLLVSIQVAYEFLSQEGELARTRLRRIRDYFAQKISWAAAGFVQPLSLPGISEQELYQKLVATGIRVGVACPP 319
gi 62185416  239 YTTALAPHALIAISAAYDHLLVAGELARKQVFALQAYFQQYFGLSSQGCGQPVFLQDLHRDLLVSLLNEANLRVSWVNFT 318
gi 89897977  239 YTTALAPHALITIGASYDHLVLEGERARQKIFNLKAYFQKPFGLSSQCCGQPVFLRDFNMDLLTSMLDEANLRVGLMTFA 318
gi 29840603  239 YTTALAPHALITIDSAYDHLLLEGEHSRKQMFSLKAYFQEHFGLHSQCCGQPIWLKDFNIDLFTSMLDEANLRVGLMTFV 318
gi 16752113  240 YSTSLSPHTLISIGTAYDFLASEGEIARKQVFKLKEHFHECFDSHAPGCVQPIFLPHTCLEEAISVLETTGIHVGVVAFA 319
gi 15618832  240 YSTSLSPHTLISIGTAYDFLASEGEIARKQVFKLKEHFHECFDSHAPGCVQPIFLPHTCLEEAISVLETTGIHVGVVAFA 319
                        330       340       350       360       370
                 ....*....|....*....|....*....|....*....|....*....|.
gi 15605510  320 TGKVLRANLHAFNTEQEVDILVSLLATEQVTYQKNVVTGSTSTMQRTLEDN 370
gi 76789519  320 TGKVLRANLHAFNTEQEVDILVSLLATEQVTYQKNVVTGSTSTMQRTLEDN 370
gi 166154994 320 TGKVLRANLHAFNTEQEVDILVSLLATEQVTYQKNVVTGSTSTMQRTLEDN 370
gi 237803207 320 TGKVLRANLHAFNTEQEVDILVSLLATEQVTYQKNVVTGSTSTMQRTLEDN 370
gi 237805128 320 TGKVLRANLHAFNTEQEVDILVSLLATEQVTYQKNVVTGSTSTMQRTLEDN 370
gi 62185416  319 DKPFIRVNFHAFNHQDEVDLLIAVLHSYLEKCGCRIDVNHEFDFGRQFCR- 368
gi 89897977  319 HRPFIRVNFHAYNNHDEVDILVAMLHSYLEKCCCGIDVDHELYFRREFCR- 368
gi 29840603  319 NKPFIRVNFHTYNTRDEVDVLVAMLHSYLEKCCCGIDIDHELYFRR----- 364
gi 16752113  320 KHPFLRVNLHAYNTVDEVNLLAQVMKPYLEKSSHRVHINHEFHLWRELCQH 370
gi 15618832  320 KHPFLRVNLHAYNTVDEVNLLAQVMKPYLEKSSHRVHINHEFHLWRELCQH 370
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap