Conserved Protein Domain Family
PRK06145

?
PRK06145: PRK06145 
acyl-CoA synthetase; Validated
Statistics
?
PSSM-Id: 102207
View PSSM: PRK06145
Aligned: 4 rows
Threshold Bit Score: 934.302
Threshold Setting Gi: 27378293
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33603673   1 MFNLSASIAFHARRTPDKAAIVYRDQEIGYAEFHQRILQAAAMLHARGISQNDVVALFMKNSAAFLELAFAASYLGAVFL 80
gi 27378293   1 MINLSSFIAFHARRTPERPALKYRGEEISYAVFDARIRKAAGWLAAQGIGAGDVVAVLMKNSAAFLELVFATSHLGAVFL 80
gi 33591821   1 MFNLSASIAFHARRTPDKAAIVYRDQEIGYAEFHQRILQAAAMLHARGIGQNDVVALFMKNSAAFLELAFAASYLGAVFL 80
gi 91780873   1 MVSLSDSVAWWARTNPSRTALMYGNQSISYGDLQRRVEATAGMLKGTRIRRGDIVALLMKNSAAFVEIMLAVSQAGAVIL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33603673  81 PVNYRLAAPEAAYILGDAGAKLLLVDEEFDAIVAlETPKIVIDAHAQADSRRLGqPGLEIPPQAAVAETDLVRLMYTSGT 160
gi 27378293  81 PINFRLSRDEVGYIAGNAGARLLMVDEELAANAA-GAKIVVLDEAAQQSVTRLA-GGAAAAPMHVRAPSDLMRLMYTSGT 158
gi 33591821  81 PVNYRLAAPEAAYILGDAGAKLLLVDEEFDAIVAlETPKIVIDAQAQADSRRLGqPGLEIPPQAAVAETDLVRLMYTSGT 160
gi 91780873  81 PINYRLGPDEVAYILQHSGAKLLFHDEEFEVPPGlVHSQAVTGA-AQSDTSVLAaGHEPCTEAYPSRPDDLYRLMYTSGT 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33603673 161 TSRPKGVMHSYGNLHWKSIDHVIALGLTASEKLLVVGPLYHVGAFDLPGIAVLWVGGTLCVHREFDPEAVLASIERHRLT 240
gi 27378293 159 TDRPKGVMLSYDNFYWKSADQTIALGLSAETRLLVVGPLYHVGALDLPGIAVLWHGGFIRIERNFEPETALAAIAEDRLN 238
gi 33591821 161 TSRPKGVMHSYGNLHWKSIDHVIALGLTASEKLLVVGPLYHVGAFDLPGIAVLWVGGTLCVHREFDPEAVLASIERHRLT 240
gi 91780873 160 TDRPKGVMHSYGNVAWKSFDHIAALGITKDDRLLVVGPLYHVGACDLPGLAVLAQGGMLRIMRDFDAQAVLEAIERERLT 239
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33603673 241 CGWMAPVMLSRVLTVPDPDRFDLDTFAWCIAGGEKTPESRIRDFTRVFTRGRFVDGFGMTETCSGDTLMEAGREIEKIGS 320
gi 27378293 239 AAWFAPVMTTAMLTCPTRDRYDVSSLTWAIGGGEKTPELRIRAFSEYFRNARYIDAYGLTETVGGDTFMEAGREIEKIGS 318
gi 33591821 241 CGWMAPVMLSRVLTVPDPDRFDLDTFAWCIAGGEKTPESRIRDFTRVFTRGRFVDGFGMTETCSGDTLMEAGREIEKIGS 320
gi 91780873 240 GAWLAPVMLSRILALPERYRFDLGSLRWVVGGGERTPEQRIREFGSLFTGARYIDAYGLTESCSGDTLMEQGRELDKIGS 319
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33603673 321 TGRALPHVEIRIADGAGGWLPANQKGEICMRGPKVTKGYWNAPEKTAEAFYGDWLRSGDVGYLDEEGFLFVTDRTKDMIL 400
gi 27378293 319 TGRAIAHVEIEIRDEEGRTLPPNVNGEICLCGPKITRGYWKDSEKTAAAFFGDWFRSGDVGYLDDEGFLYLTDRKKDMII 398
gi 33591821 321 TGRALPHVEIRIADGAGGWLPANRKGEICMRGPKVTKGYWNAPEKTAEAFYGDWLRSGDVGYLDEEGFLFVTDRTKDMIL 400
gi 91780873 320 TGRALAHVQLAIMSDDGRMLAPGMQGEICVRGPKVTQGYWKDPEKTARSFVDGWFRTGDVGYMDEEGFLYLTDRKKDMII 399
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33603673 401 TGAENVASSEVEAALYELPQIAEAAVIGVHDDKWGERITAVVVLNPGQTLTLEEIDRHCRQRLASFKVPRELKVVAELPR 480
gi 27378293 399 SGGENIASSEVERVIYELSEVREVAVIGLRDARWGERPVAIVVLAEGASLELPALTEHCRARLASFKVPKQLVVRDSLPR 478
gi 33591821 401 TGAENVASSEVEAALYELPQIAEAAVIGVHDDKWGERITAVVVLNPGQTLTLEEIDRHCRQRLASFKVPRELKVVAELPR 480
gi 91780873 400 SGGENIASSEVERVIYQLAEVAEAAVIGAPDPRWGEQVTAVVVLRAGATLTLDALRTHCEGRLGGFKTPRQLILRDALPR 479
                       490       500
                ....*....|....*....|...
gi 33603673 481 NPSGKVLKRVLRDEY------NG 497
gi 27378293 479 NPSGKILKRVLRAEL------ET 495
gi 33591821 481 NPSGKVLKRVLRDEY------NG 497
gi 91780873 480 NPSGKVLKRVLRDELlkesdhDG 502
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap