Conserved Protein Domain Family
PRK06388

?
PRK06388: PRK06388 
amidophosphoribosyltransferase; Provisional
Statistics
?
PSSM-Id: 102351
View PSSM: PRK06388
Aligned: 3 rows
Threshold Bit Score: 827.247
Threshold Setting Gi: 48477741
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16082247   1 MDSLPPGSDPIDGQKPSEDCAVVGFKGRINAYEPIITALRTLQHRGQESAGMAVFDGRKTVLKKGRGLVTDVFNPATDSI 80
gi 13541185   1 MDSRPQGSDPINGQKPSEDCAVVGFKGKINAYNPIITALRTLQHRGQESAGMAVFDGKKVTLKKGSGLVTDVFNPATDDI 80
gi 48477741   1 MDSQPQESDITTGQKVNEDCAVIGFSGG-GVYSSIIAGLRSLQHRGQESSGIITYDG-KIHVKKGMGLVSEVFKNA-DPM 77
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16082247  81 KGKVGVGHTRYSTAGSKDVIDAGPFVINSQVGFISLSHNGEIVNADELKEEMKKEGVNFQSDSDTEVLLAELSRNISKYG 160
gi 13541185  81 KGYVGVGHTRYSTAGSKNVVNAGPFVMNSSFGYITISHNGEIVNADELRDSMKKEGITFQSDSDTEVMLAELSRNISKYG 160
gi 48477741  78 PGIVGIGHNRYSTSGSKGIENAGPFVISCSLGYIGITHNGEITNEHELREELKHDGYIFTSSSDTEVMLIEFVKEISRYG 157
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16082247 161 LKKGFEVSMNTLRGAYACAVGINDRLFAMRDPNGIRPLIVGKNADGYIIASESCAIDALDGTIIRNVEPGEVVELTDDGL 240
gi 13541185 161 LKRGFEQSMESLRGAYACAISINDRLYAVRDPNGIRPLVIGKNNDGYIVASESCAIDALEGTLIKNIEPGEVVEISDEGI 240
gi 48477741 158 INEGIKRGMERLKGAYAAVLMINDRLYAIRDKFGFRPLVLGRTFNGYIIASETCAIDALSGETIKNVEPGEVIEVFNNSY 237
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16082247 241 KTIALHEGEKTAHCMFEYVYFSRPDSTIDGINVYMARVKMGMMLAKESPVEADMVIPVPDSGRSQAIGFSMQSGIPYTEG 320
gi 13541185 241 RTIVSKSANRIAHCMFEYVYFSRPDSVIDGINVYAARVNMGRILAKESPVEADIVVPVPDSGRSQAIGYSMESGMPYTEG 320
gi 48477741 238 KTIFKLDGD-VSHCMFEYVYFARPDSIIDNIEVFQARVRMGMRLAVESPVDADVVVPVPDSGRAQALGFSKATGIPYSEG 316
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16082247 321 LMKNRYSERTFIMPTQSDRKAAIRLKLNPVREVISGKRIVLVDDSIVRGNTMRFIVSMMRKYGAKEVHVRIGSPHIIAPC 400
gi 13541185 321 LIKNRYSERTFIMPTQSDRKAAIHLKLNPIREVIGGKKVVLVDDSIVRGNTMRFIVGLMRKYGAKEIHVRIGSPHIIAPC 400
gi 48477741 317 LIKNRYSERTFIMPDQKSRLAAIKIKLNAIKSEISNKRIVLVDDSIVRGNTMKYIVKIVRDAGASEVHVRISSPPITAPC 396
                       410       420       430       440       450       460       470
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 16082247 401 YFGVDMKTKDQFIARGKTDAEINSEIGADSLAFLSIDGLKEAIGLDENNLCLGCLTGTYPIDISKKLAEKITQY 474
gi 13541185 401 YFGVDMKTKDQFIARGKTDEEINREIGADSLAFLSVDGLKQAISMKNNNLCLGCLTGEYPIDISKKLAENITSY 474
gi 48477741 397 FYGVDMKTKNEFIAANKTIESIKNEIGADSLAYLSIDGLKQAIGIK--SICISCLTGIYPEYVPLS-------- 460
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap