Conserved Protein Domain Family
PRK06392

?
PRK06392: PRK06392 
homoserine dehydrogenase; Provisional
Statistics
?
PSSM-Id: 102354
View PSSM: PRK06392
Aligned: 3 rows
Threshold Bit Score: 502.864
Threshold Setting Gi: 16082189
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48478489   1 MRISIIGLGHIGLSVLDIIKSRNDdyRKNNNGISIVSASDSKlTLYNENGLDPGKIINYKKS-KRLEEIDYEkiKFDEIF 79
gi 16082189   4 IRIILMGTGNVGLNVLRIIDASNR--RRSAFSIKVVGVSDSR-SYASGRNLDISSIISNKEKtGRISDRAFS--GPEDLM 78
gi 13541216   4 INLSIFGLGNVGLNLLRIIRSFNEe-NRLGLKFNVVFVADSLhSYYNER-IDIGKVISYKEK-GSLDSLEYEsiSASEAL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48478489  80 EIKPDVIVDVSPATKDGIRGKNLYINAFEHGIDIVTANKAPLALHWHDIMDSASKNRRIIRYEASVGGGVPLFNLRQFCT 159
gi 16082189  79 GEAADLLVDCTPASRDGVREYSLYRMAFESGMNVVTANKSGLANKWHDIMDSANQNSKYIRYEATVAGGVPLFSVLDYSI 158
gi 13541216  81 ARDFDIVVDATPASADGKKELAFYKETFENGKDVVTANKSGLANFWPEIMEYARSNNRRIRYEATVAGGVPLFSFIDYSV 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48478489 160 MSSRIINFTGLVSSTINYVLNQELSGVGFLDAVKIAQNMGIAETDYSDDTMGLDSARKTVILANSLFNKDITLRDVTYDG 239
gi 16082189 159 LPSKVKRFRGIVSSTINYVIRNMANGRSLRDVVDDAIKKGIAESNPQDDLNGLDAARKSVILVNHIFGTEYTLNDVEYSG 238
gi 13541216 161 LPSRIKKFRGIVSLTINYFIRELANKREFDDVLSEATKLGIVEKNYKDDLTGLDAARKSVILCNHLYGSSYRLSDVFYEG 240
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48478489 240 IEniDISSMDNEKVYRVVAMIenNGGFHAESKIRAFSRNDFLGMISPLSMAYSMETDINDNINIFENHDGPLQTAAQVVN 319
gi 16082189 239 VD--ERSYNANDRLVTEVYVD--DRRPVAVSRIISLNKDDFLMSIGMDGLGYQIETDSNGTVNVSDIYDGPYETAGAVVN 314
gi 13541216 241 ILdqDRSFGKNERLVTETGIV--NGKPSAESRIKSLDSNDYLLTLGKGSLGYQLQTDTNGTLNVSDLYDGPYETAGAVMN 318
                       330
                ....*....|
gi 48478489 320 DVMLL-KYKI 328
gi 16082189 315 DILLLsKVQK 324
gi 13541216 319 DLVILsMFTV 328
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap