Conserved Protein Domain Family
PRK06395

?
PRK06395: PRK06395 
phosphoribosylamine--glycine ligase; Provisional
Statistics
?
PSSM-Id: 102357
View PSSM: PRK06395
Aligned: 3 rows
Threshold Bit Score: 730.166
Threshold Setting Gi: 48478022
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16082534   1 MTEKVMIVGSGGREDAIAMAIKRSGAILFSAIGHENPSIKSLSSKYLVVNELDYRKIEDFAADNLVDMVFIGPDPVLDTP 80
gi 13541456   1 MVSRVLLIGSGGREDAIARAIKRSGAKLFSVIGHENPSIKRLSEKYLIGDEKDYKSIEDFALSSSVDIVFVGPDPVLETP 80
gi 48478022   1 --MKIMLVGSGGREDSIARNIALNHE-LYSVLTNENPSIIKNSKKYIFYDKKRHDLIADFALKNNIDIAFVSPDGILANG 77
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16082534  81 LVNNLLRRGIPVASPTMEAARIETSKMFMRELMKRHNIPGNVNFRECFSEEDLESALRDLGPEVAVKPIGLTGGKGVKVV 160
gi 13541456  81 LVNNLLKRGIAVASPTMEAAQIETSKMFMRDLLTRHSIPGNINYKKCFSEQEVKDFFDKNKKDVAVKPIGLTGGKGVKVM 160
gi 48478022  78 LADDLIKNKIKTASPVKSAAMIETSKAYMRYIMEKYNIPGNIE-NATFNNKDAARDYITSMKDVAVKPIGLTGGKGVKVT 156
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16082534 161 GEQLETVEDARRYAIEILRRDGVVLIEEKMVGEEFSLQAFVDGKXXSFMPIVQDYKRAYEGDAGPNTGGMGSISDSSFTL 240
gi 13541456 161 GEQLKSQGEAINYAIEVLQRDGVVLIEDRMIGEEFSLQAFTDGKNTSFMPIVQDYKRAFEGDTGPNTGGMGSISDVNFSL 240
gi 48478022 157 GIHLNS-DEAIRYACDIIDRDGQVLIEKKETGEEFSLQAFSDGSHLSFMPVVQDYKRLYEGDHGPNTGGMGSISDRDFSL 235
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16082534 241 PFISDRAPEEAKHILVDIIRAMNSENTPFKGIMYGQFMDTPHGVKVIEINARFADPEGINVLTLLKSDFVETLHQIYDGN 320
gi 13541456 241 PFLSKKAPEDARHIINDVVRAMYDENIPFKGVMYGQFMDTPDGVKVIEINARFADPEGINVLSLLKSDFVETLYQIYSGE 320
gi 48478022 236 PFLRKDTPERAKKILNKIIEAMKDENNVFKGIIYGQFMETDNDVKVIEINARFGDPEAINVNYILDDDLGIIFHDILSGN 315
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16082534 321 LQGDKIFERKASVLKYIVPIGYGSDPKPGEIELDKAIFDSGVDVLYASVSGDMLRLKQSTSRSLAIIAKGNSIPEASELV 400
gi 13541456 321 LNGERLFEDRATVLKYIVPPGYGQAPLPGDLHIDPEIEKLDTELYYAAVSGTLYDVKMSSSRSLAILGKADNIPEASEMV 400
gi 48478022 316 VNRSIKYMRKATVLKYIVPPGYPENPSKVRIKIDKTL---NSDVYYASVSGTLNDVETLGSRSIAIIARGDSIEDAYLKC 392
                       410       420       430
                ....*....|....*....|....*....|....*
gi 16082534 401 DSSLAHVKGSYYVRRDIGRSDFIQSKIRKAKALLG 435
gi 13541456 401 DSALKYVHGSYYVRRDIGKKEFLEKKIMAASRAKS 435
gi 48478022 393 ESDLNAIHGEFYVRHDIGD---IRKKIKN------ 418
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap