Conserved Protein Domain Family
PRK06404

?
PRK06404: PRK06404 
anthranilate synthase component I; Reviewed
Statistics
?
PSSM-Id: 102361
View PSSM: PRK06404
Aligned: 3 rows
Threshold Bit Score: 548.316
Threshold Setting Gi: 48477414
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13541855   1 MLADQIDEFRTySNFAYFASFPDRvNGYEYVFASDTFQN---DPSKIFDGALRPILVTYDYVNEI--------FDTKVKS 69
gi 48477414   1 MIYNNIEKFED-KNFAYFCKFNGN-TGQERLFVSDDYNTlykDSEGFLEGEVYDLINKNEFIPACatyslanyFNNIYEK 78
gi 16082560   2 NLIDELSEYRDrGSLAYFASFPDRiSGYEYAFLGDGMIT---DPERIFDGKLRPLIVTYDFVNSV--------FGQKVRR 70
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13541855  70 SGWPYFLSMDAETIEKRPIMRTSAFKKKNSGSLKDEALEGKIRKIVNLIRNGEVLQVVISREFE-ANVNVNEKIHEFLTK 148
gi 48477414  79 EKYPYFYYMIPERSYKSNIERKSFKTVSLKSNYNDISMSLKIKELIERIRAGELLQVVISREFYlKNIDFKRLLSSFINN 158
gi 16082560  71 SGWPEMVSFDPDTVMKRRIVRSGYLTRKEVGDFSDPDLSRKIAEVRDLIRSGEVLQAVISRDFE-ACIDPWEKLREFIDH 149
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13541855 149 DRSRYVFYYRFGKYEVVGSSPENIFTVIGNRIYVDPIAGT-------ISHSFSSDTLYRSEKDRCEHRMLLDLARNDVSK 221
gi 48477414 159 DSSLYVYYYKFGDTRIIGSSPENVFTINNNIINVRPIAGTrrrgsdeYDDKILENELLNNEKEKLEHRMLLDLARNDLGR 238
gi 16082560 150 DRSRYVFYYRIGKYQVVGSSPENLVTVSGNEVFTDPIAGT-------VPSTVRSSVLLESMKDANEHRMLLDLARNDLSK 222
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13541855 222 FADIGSLEVPKVMEIEEFSSVKHLVSQVKATfSNKNYVDILRAMFPAGTVTGSPKERAIEIIDKFEETPRGPYGGAVGIV 301
gi 48477414 239 ICEPGTVNVDYSMKIEKFLTVQHMVSSVTGK-TNASLRDIFASVFPAGTVSGAPKKRAMELINKYEDNIRKEYAGAIGII 317
gi 16082560 223 FADIGTLGVSKVMQIEEFSSVKHLVSQVRASfSNTPYLDILKSMFPAGTVSGSPKERAIEIIEKYEETPRGPYGGSIGIT 302
                       330       340       350       360       370
                ....*....|....*....|....*....|....*....|....*....|
gi 13541855 302 GSGIFDMGLAIRMAYSSGNGFRVRAGAGIVKDSDPSSEVNEIYNKARSVL 351
gi 48477414 318 SKDYTDMALVIRTIFSHDNVVTARAGAGIVKDSIPEDEVNEMFSKAMTVM 367
gi 16082560 303 MDGMMDLALTIRSAYSDGSGFRVRAGAGIVKDSDPDAEVREIYSKARSVI 352
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap