Conserved Protein Domain Family
PRK06423

?
PRK06423: PRK06423 
phosphoribosylformylglycinamidine synthase; Provisional
Statistics
?
PSSM-Id: 102368
View PSSM: PRK06423
Aligned: 3 rows
Threshold Bit Score: 114.602
Threshold Setting Gi: 48478276
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 48478276  1 MKAKIEVTYLPNVEDPEALSIEKNLSMLGYNGIKGLSIKKIYEFtlDDDSYNVLDEIAGRILTNPVIQSYKIIRD 75
gi 16082584  1 MKFRVEIRYKEGVEDPEAVTILKNFNILGYKGIRDVRTSKVYYI--DADDRDEVSEITSKILANPVIHTYTIEAI 73
gi 13541382  1 MKFKVEVSYKPGVEDPEALTLLKNLNILGYHEISNVSISKVYYF--DAGNEEEVKQVADKILSNPVIHSYKVEKL 73
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap