Conserved Protein Domain Family
PRK06425

?
PRK06425: PRK06425 
histidinol-phosphate aminotransferase; Validated
Statistics
?
PSSM-Id: 102370
View PSSM: PRK06425
Aligned: 3 rows
Threshold Bit Score: 445.066
Threshold Setting Gi: 48477885
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16082471   1 MRKHGGDVYAYSGQYEN----ILDFSANTNAFIDTGVLSRYPEVSPGDIEKMILQYTGAKSLR---------VIIGPGLT 67
gi 13540909   1 MRSHGGDVYKVSPNYDR----ITDMSSNVNPFLDLGKYSLYPEISYTDIEEKLRVYTKSTNMG---------IVIGPGLT 67
gi 48477885   1 -MGHGGNVLEAASKSGRsirdIIDFSASINDFMEINDIIIK--------KDQIKIYPQGLKIKnkslcefndVLPVPGLT 71
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16082471  68 HFIYRIPAWMGLRRSLIIEPNFNEYEASLLAYGSRTSSLGLGVLKRNPEIVRSYRPDSIFICSPVNPTGDLVDAGLLRKL 147
gi 13540909  68 HLIYKYFEFYQVKKPIIAMPNFSEYKGIAEDRHLRFSAIPSYIIEKDPLILKNFDHDALFITSPSNPFGELFPESTLETV 147
gi 48477885  72 FFIHRLLSYIN-GNIIIVEPTFNEYK-YAFTHGIRIN-LPFNLINNNPEILNNYNFSLIIIVYPDNPLGNLISRDSLLTI 148
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16082471 148 SMEMSRMGGILFVDQAFGDFVPEHAEETVRIAEEMGNVIIGRSLTKILSIPSLRLGYILVSDQVFGMIRDREEPWAVCEP 227
gi 13540909 148 FEIEEKRGRRVFLDGAFMDFVPNYAESIVQSSRSYFNVTIGRSLTKILAIPSLRAGYLIMERHEADLFRKAMEPWSICQP 227
gi 48477885 149 SEICRKKSALLFIDESFIFFLKNRYNEDDLLN---GSTIIGRSLTKILGVPSLRIGYIATDDYNMKISKKITGPWSVPDY 225
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16082471 228 ALEFVRKADLKALRDTSLKRIGEERSYLMEALENMGFEILGDPHANFIAFRSP---FEIDLKKQLLKSGILIRDLSDYAD 304
gi 13540909 228 AIDFIRSIDINEVAKNSVALVNGEREYLISELKARGIKVIGNPSANYIVISMP---RTDEFYNFMLSKGILVRLLDDYDY 304
gi 48477885 226 VIDYINSIKLDY---HFLDIMENEKSFMINNMEAMGFRAAGDHSANFITFMIPdfiDAHDFYSYLIKNGILVRLLDDYEC 302
                       330       340
                ....*....|....*....|....*...
gi 16082471 305 FGKNCYRVAVRGRSENALLIQALRNAIL 332
gi 13540909 305 VGRCLVRLAIKTRSQNNAFLNALDNFMS 332
gi 48477885 303 LGEQYIRIGIRRHEFNIKLVNAIRGFLN 330
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap