Conserved Protein Domain Family
PRK06432

?
PRK06432: PRK06432 
NADH dehydrogenase subunit A; Validated
Statistics
?
PSSM-Id: 102372
View PSSM: PRK06432
Aligned: 3 rows
Threshold Bit Score: 210.824
Threshold Setting Gi: 16082575
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48478472   1 MLSGYIPLAVMLIIIVLVMYLLFIILPAISANRYKpDKRISFKRKDIIENLNIQNNPPASDDSYLHPFESGEVAKEYREG 80
gi 16082575   8 MLDGYIPLLIIIVVIPLALIFGFKILPALGANRYG-DNTVKLDTETILKKAAYEDTPPGVDQKYLEPYESGEVAREIWGK 86
gi 13541947   8 MLDGYIPLLIIIVVLPLALIFGFKILPALGANRYG-DNKISLRTEDILKKAAYEDTPPGEDQRYLEPYESGEVAREIWGR 86
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 48478472  81 NVTIQYYIIVLLFVLFDIDMLLLLPWAFDFYRLGLLPFIETILFLVMPLFAVYYAFKMGYMRWMK 145
gi 16082575  87 PSINQYYVVVLLFVVFDVDMLLLFPWAVDFKQLGLIKFIETLIFLAMPLFGVYYAFKHGYMRWLK 151
gi 13541947  87 PSINQYYIVVLLFVVFDVDMLLLFPWAYDFKSLGLIPFIETLIFLAMPLFAVYYAFKLGYMRWLK 151
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap