Conserved Protein Domain Family
PRK06434

?
PRK06434: PRK06434 
cystathionine gamma-lyase; Validated
Statistics
?
PSSM-Id: 102374
View PSSM: PRK06434
Aligned: 3 rows
Threshold Bit Score: 674.309
Threshold Setting Gi: 48478174
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16081253   1 MVSHRYKGFNTKAVQSGELRDPRFGNVTTPIFETSTFVYPNPEKEAYTDHTRDQPYIYTRWGNPTVQAFEEKYAAVEGAE 80
gi 13541005   2 AEKRLFNGFNTRAVQSGELRDPRFGNVTTPIFETSTFVFPNSEKDAYIDNTRNLPYIYTRWGNPTVQAFEEKYASLEKAE 81
gi 48478174   1 ----MLNGFNTRAVQAGDLKIREIGNVVTPIFENSTFIYPNSESE-YMDSSSGMPYIYSRWGNPTVQSLEDKYRVLENTG 75
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16081253  81 YALSFSSGMGAITSAITGLLHPGSRMLSLSDLYGQTFYFFNKVLGDLGIKVDYIDTERINSLDFDPSKYDAIYMESITNP 160
gi 13541005  82 HALSFSSGMGAITSVILALAERGDKILSVSDLYGQTFYFLNKVLPEYGISVEYISTDRLNSGEFKPSDYDIIYLESITNP 161
gi 48478174  76 HAVAFSSGMGAITAAVLSNIKK-KRILSIMDLYGQTFQFFSRTLKTLGIHVDFIDVDKLNNLDFDAKNYDLVYAESITNP 154
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16081253 161 TLKVPDIRSVSDYAKKSLVIV--DATFASPYNQHPLDLGADVVIHSATKYIGGHSDIVMGVVGTNSKEIFNSLVIRRKTY 238
gi 13541005 162 TLKVPDIKAVSERSTGKKIIV--DATFASPYNQNPLDLGADVVIHSATKYISGHSDVVMGVFSTNDKSIFDKVVVRRKTF 239
gi 48478174 155 LLKVIDIKNVASFCHENDVLFidDATFASPYNQNPVELGADIVVHSATKYISGHSDVIIGIAGTNN--YYNNLIEMRKTL 232
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16081253 239 GSNPDPIQAYLALRGLKTLGLRMEKHNRNGMEIATFLRKNDSISRVYYPDTE------MGKKVLSGFGGMVSFEIRRDRD 312
gi 13541005 240 GSNPDPIQSYLALRGIKTLGLRMEKHNKNGMELAKYLRTEPRISHVYYPDTE------IGKKVLRGFGGMISFELRPELD 313
gi 48478174 233 GASPDAFQAYLSYRGLKTLGLRMERHNKNAMELARFLRDSKKVLNVNYPGLDdnkyhgIAGKEMRGYGGMLSFTLNSMED 312
                       330       340       350       360       370       380       390
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 16081253 313 VHSFLRKLSIPMVAASLGGVESLITLPAETSHSSLSREERERMGISDNLVRFSIGIEDAEDLIADIQNALGA 384
gi 13541005 314 VHVFMRNLKIPMVAASLGGVESLITLPVETSHSSMTKEERERIGITDNLVRFSIGIEDHVDLIDDIKQALDK 385
gi 48478174 313 AHKLIKNLEIPAYAASLGGVESLITMPVETTHASLSPEERRSLGISDSLVRFSTGIEDIDDIIKDFENALSK 384
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap