Conserved Protein Domain Family
PRK06438

?
PRK06438: PRK06438 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 102377
View PSSM: PRK06438
Aligned: 3 rows
Threshold Bit Score: 430.821
Threshold Setting Gi: 48477257
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16082577   1 MVKTLVYGLYPRTEKLRRSYNRWERGLMKSQEIAEIVREEKYEFYDLLERSGIDEYTDPLFNWYDILRPIILSMENVKLG 80
gi 13541955   2 VVKSLVYGIYPRSERLRKAYNRWERGLVGNEEIRRTISEEKDRFYEYVKSVGISEFTDPLFNWHDIFRPIALSVSGVTLG 81
gi 48477257   2 SVKKLVYGIYPKTNELRLEIGRWERGIIPDSVLNEKINDEKYIFYDKVKDI---YYTDPLYNWYDIFRPLSRIVNGISLG 78
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16082577  81 PLTRYLETNTFYRMPEFYGIPAINRNLVEFGEMDENPPLPAYHLDKNASI--FLPSPYSVFKMSRFMEKISENDFYAALV 158
gi 13541955  82 PLKRYLETNTFYREPEISGHITLQRKLDTFDLLEENPPLPLFALAKGSSI--FLPTPSSFYKMSSVKANIGAEELYKDLV 159
gi 48477257  79 PLTRFLETNTFYRIPEISDVKDFNLEPDKFQKIDDNPPLPLY-LKHGINFhgLLPSPYSFYYMSKTL--MDYNDFNKKIL 155
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16082577 159 REYGKIAKTFGVSKVVLFDVFEYGNHNVSYLDPLLDSAKVTLIARGSPSADNFAGLGHRFEYI-VADSMNGDMRKFTRGI 237
gi 13541955 160 NVYSDIIDIFKPRSLVLYEVFPYNGDNLSYLESLNQKISVHLLTKGKISEKNFNGIKHKFESI-ISDDHPEFLKNYAKYY 238
gi 48477257 156 NIYSRILDIYSIKNVVLLDPLYYKNDAYIDLSDFAKKYNVILITSGNVSKLKING---KLESIaVRPDEVDYIINKCSYP 232
                       250       260       270       280       290
                ....*....|....*....|....*....|....*....|....*....|....*.
gi 16082577 238 GAKVVSAHRTKIEDVAA-GKRPRDDSVELITHDDYMDFLPREIADIKVEILGKMGD 292
gi 13541955 239 GFKIIDVNKTKVEDPNA-DYGIENYEDAIVTSNDYFDFLPREIADIKVEVLGKVGE 293
gi 48477257 233 GISIFSGDNTKMEDLKTiRKEISGYDNVLLTHSTYMDFLPRVIADKKMDLILEA-- 286
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap