Conserved Protein Domain Family
PRK06444

?
PRK06444: PRK06444 
prephenate dehydrogenase; Provisional
Statistics
?
PSSM-Id: 102381
View PSSM: PRK06444
Aligned: 3 rows
Threshold Bit Score: 298.301
Threshold Setting Gi: 48477908
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13542181   1 MKVGIIGKQGRLGRVLQAILDE---------NGFDVvENNWDIAFLSVPIGAAISYIEKYD-GPFIEVSSVKTPFKKYAG 70
gi 16082503   9 LRAAIIGKEGRLGRVLSSILTG---------NGVQI-DDGADLAFLSVPIKAAMEYIERRD-RTYVELSSVKSVFRKYSG 77
gi 48477908   1 -MEIIIGANGRFGSLLCSLLDDricididniNELGVyIKKADHVFLSVPVDAALNIIDSYDyNNFVEISSVKWPFKKYSG 79
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13542181  71 RIVSIHPLFGPASYKDGVHRTVLFIKDISMPEYRDLIAEMFRGYEIVDTTADVHDKEMAKSLALPYAVAIISKNIDTAFR 150
gi 16082503  78 SIVSIHPLFGPSSYNDGLHRTIIFVTDISNVKYKEIIEEMFRGYDLVSMSAEEHDRMMVSDMVIPYLMSMIARRIEAGYH 157
gi 48477908  80 KITSIHPLFGPMSYNR--INDVIFINDISRDNSLNELNKIFKNWHFIEMTSDEHDLLMSEIMVKPYIISMML-DCKSDIK 156
                       170       180       190       200
                ....*....|....*....|....*....|....*....|....*...
gi 13542181 151 TKSFDTFKGIVRILENENEEVMLDTINKNPYA-QYMYDIVKNLGMVIQ 197
gi 16082503 158 TRSFDMARSLASIVEGENPEVVMDTIRLNPFS-GMARDMINDVMSVIP 204
gi 48477908 157 TGSYKKLLEVSEIKNKESWKVFNDTLIYNPYTmNVINDLIERLNKTRD 204
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap