Conserved Protein Domain Family
PRK06628

?
PRK06628: PRK06628 
lipid A biosynthesis lauroyl acyltransferase; Provisional
Statistics
?
PSSM-Id: 102471
View PSSM: PRK06628
Aligned: 13 rows
Threshold Bit Score: 565.711
Threshold Setting Gi: 51473888
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15893014    1 MKKFLKKLRYLIEYFIVVIFLKVIGIFGVDKAADICSFIARKVGILFAVNKIARRNIKVVFGDMCDVEKIIDQTWDNFGR 80
gi 15604555    1 MKKFLKKLRYLIEYFIVIIFLKVIGIFGIDKASDICSFIARKVGILFAVNKIAKRNIKAVFGDMYDVEKIIDQTWDNFGR 80
gi 157828939   1 MKKFLKKLRYLIEYFIVVIFLKVIGIFGVDKAADICSFIARKVGILFAVNKIARRNIKVVFGYMCDVEKIIDQTWDNFGR 80
gi 165933663   1 MKKFLKKLRYLIEYFIVVIFLKVIGIFGVDKAADICSFIARKVGILFAVNKIARRNIKVVFGYMCDVEKIIDQTWDNFGR 80
gi 51473888    1 MKKFLKKLRYLIEYFIVIIFLKVIGIFGIDKASDICSFIARKVGILFAVNKIAKRNIKAVFGDMYDVEKIIDQTWDNFGR 80
gi 157826137   1 MKKFLKKLRYLIEYFIVVIFLKVIGIFGVDKAADICSFIARKVGILFAVNKIAKRNIKAVFGDMCDVEKIIDKTWDNFGR 80
gi 157804099   1 MKKFLKKLRYLIEYFIIVIFLKVIGMLGMDKAADICSFIARKIGILFAVNKIARSNIKAVFGDMCDVEKIIDQTWGNFGR 80
gi 91205001    1 MKKFLKKIRYLIEYAIVIIFLKIIGIFGIDKAADICSFIARKIGILFAVNKIARRNVKAVFGDAFDVEKTIDQTWDNFGR 80
gi 157827667   1 MKKFLKKIRYLIEYAIVIIFLKIIGIFGIDKAADICSFIARKIGILFAVNKIARRNVKAVFGDAFDVEKTIDQTWDNFGR 80
gi 229587070   1 MKKFLKKLRYLIEYFIVVIFLKVIGIFGVDKAADICSFIARKVGTLFAVNKIARRNIKVVFGDMCDVETIIDQTWDNFGR 80
gi 157964861   1 MKKFLKKLRYLIEYFIVVILLKVIGIFGVDKAADICSFIARKVGILFAVNKIARRNIKVVFGDMCDVEKIIDQTWDNFGR 80
gi 67458589    1 MKKFLKKLRYLIEYFIVVIFLKVIGIFGVDKAADICSFIARKVGILFAVNKIARRNIKAVFGDMCDVEKIIDQTWDNFGR 80
gi 238650374   1 MKKFLKKLRYLIEYFIVVIFLKVIGIFGVDKAADICSFIARKVGILFAVNKIARRNIKVVFGDMCDVEKIIDQTWDNFGR 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15893014   81 FIGEFTYVSKMDEAELERRIAIIGIENIKKLEGQPFLLFGGHFANWDISIKILHKFYPKVAVIYRKANNPYVNKLVNESR 160
gi 15604555   81 FIGEFIYVDKMDESELESRIEIIGKENIKKLEDQPFLLFSGHFANWDISLKVLKKYYPKVAVIYRKANNPYVNKLVNESR 160
gi 157828939  81 FIGEFTYVSKMDEAELERRIAIIGIENIKKLEGQPFLLFSGHFANWDISIKILHKFYPKVAVIYRKANNPYVNKLVNESR 160
gi 165933663  81 FIGEFTYVSKMDEAELERRIAIIGIENIKKLEGQPFLLFSGHFANWDISIKILHKFYPKVAVIYRKANNPYVNKLVNESR 160
gi 51473888   81 FIGEFTYVDKMDESELERRIEIIGKENIQKLEDQPFLLFSGHFANWDISLKVLKKYYPKVAVIYRKANNPYVNKLVNESR 160
gi 157826137  81 FIGESAYVNKMSDAELEHRAEIIGIENIRKLGERPFLLFSGHFANWDIGLHLLHKSYSKFAVIYRKANNPYVNKLINESR 160
gi 157804099  81 FIGEFAYVNKMNEVELKRRIEIIGIENIKKLEGQPFLLFSGHFANWDIALKRLYKSYPKFAVIYRKANNPYVNKLVNESR 160
gi 91205001   81 FVGEFAYINEMDELELERRIEIIGLENIKKLKGQPFLFFTGHFANWDIAVKIIHKIYPKFAVIYRKANNPYVNKLINESR 160
gi 157827667  81 FVGEFAYINEMDELELERRIEIIGLENIKKLKGQPFLFFTGHFANWDIAVKIIHKIYPKFAVIYRKANNPYVNKLINESR 160
gi 229587070  81 FIGEFTYVSKMDEAELERRITIIGIENIKKLEGQPFLLFGGHFANWDISIKILHKFYPKVAVIYRKANNPYVNKLVNESR 160
gi 157964861  81 FIGEFTYVGKMDEAELERRIEIIGIENIKKLAGQPFLLFSGHFANWDISLKLLHKFYPKVAVIYRKANNPYVNKLVNESR 160
gi 67458589   81 FIGESAYVNKMSEAELENRAEIIGIENIKKLGEQPFLLFSGHFANWDIGLNLLHKSYPKFAVIYRKANNPYVNKLINESR 160
gi 238650374  81 FIGEFTYVSKMDEAELERRIAIIGIENIKKLEGQPFLLFSGHFANWDISIKILHKFYPKVAVIYRKANNPYVNKLVNESR 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15893014  161 AGDKLRLIPKGPEGSRALVRAIKESESIVMLVDQKMNDGIEVPFLGHPAMTASAIAKIALQYKYPIIPCQIIRTKGSYFK 240
gi 15604555  161 AGDKLRLIPKGSEGIRSLVRAIKEGESIVMLVDQKMNDGIEVPFLGRPSMTASSIAKIALQYKYPIIPCQIIRTKGSYFK 240
gi 157828939 161 AGDKLRLIPKGPEGSRALVRAIKESEAIVMLVDQKMNDGIEVPFLGHPAMTASAIAKIALQYKYPIIPCQIIRTKGSYFK 240
gi 165933663 161 AGDKLRLIPKGPEGSRALVRAIKESEAIVMLVDQKMNDGIEVPFLGHPAMTASAIAKIALQYKYPIIPCQIIRTKGSYFK 240
gi 51473888  161 AGDKLRLIPKGSEGIRALVSAIKEGESIVMLVDQKMNDGIEVPFLGRPSMTASAIAKIALQYKYPIIPCQIIRTKGSYFK 240
gi 157826137 161 AGDKLRLIPKGPEGRRALVRAIKDGESIVMLVDQKMNDGIEVPFLGHPAMTANAIAKIALQYKYTIIPCQIIRTKGSYFK 240
gi 157804099 161 ASDKLRLIPKGPEGSRALFRAIKEGESIVMLVDQKMNNGIEVPFLGYPAMTANAIAKIALQYKYPIIPCQIIRTKGSYFK 240
gi 91205001  161 ASSKLRLIPKGPDGSRALVRAIKGRESIAMLVDQKMNDGIEVPFLGYPAMTANAIAKIALQYGYPIVPCQIVRTKGSYFK 240
gi 157827667 161 ASSKLRLIPKGPDGSRALVRAIKGRESIAMLVDQKMNDGIEVPFLGYPAMTANAIAKIALQYGYPIVPCQIVRTKGSYFK 240
gi 229587070 161 AGDKLRLIPKGPEGSRALVRAIKESESIVMLVDQKMNDGIEVPFLGHPAMTASAIAKIALQYKYPIIPCQIIRTKGSYFK 240
gi 157964861 161 ASDKLRLIPKGPEGSRALVRAIKESASIVMLVDQKMNDGIEVPFLGHPAMTASAIAKIALQYKYPIIPCQIIRTKGSYFK 240
gi 67458589  161 TSDKLRLIPKGPDGSRALVRAIKESESIVMLVDQKMNDGIEVPFLGHPAMTANAIAKIALQYKYPIIPCQIIRTKGSYFK 240
gi 238650374 161 AGDKLRLIPKGSEGSRALVRAIKESESIVMLVDQKMNDGIEVPFLGHPAMTASAIAKIALQYKYPIIPCQIIRTKGSYFK 240
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|
gi 15893014  241 VIVHPQLKFEQTGDNKADCYNIMLNINQMLGEWVKQNPAQWFWFHNRWKK 290
gi 15604555  241 VIVHPQLKFEQTGDNKVDCYNIMFNINQILGEWVKQNPAQWFWFHNRWKK 290
gi 157828939 241 VIVHPQLKLEQTGDNKADCYNIMLNINQMLGEWVKQNPAQWFWFHNRWKQ 290
gi 165933663 241 VIVHPQLKLEQTGDNKADCYNIMLNINQMLGEWVKQNPAQWFWFHNRWKQ 290
gi 51473888  241 VIVHPQLKFEQTGDNKVDCYNIMFYINQILGEWVKQNPAQWFWFHNRWKK 290
gi 157826137 241 VIVHPQLEFEQTGDNKADCYNIMLNINQMLGEWVKQNPSQWFWFHNRWKK 290
gi 157804099 241 LILHSQLMFEQSGDNKVDCYNIMLNINQILGEWVKQNPSQWFWFHNRWKK 290
gi 91205001  241 LIIHPNLTWEQTGDSKTDCYNIMLNINQILGDWVKQNPSQWFWFHNRWKK 290
gi 157827667 241 LIIHPNLTWEQTGDSKTDCYNIMLNINQILGDWVKQNPSQWFWFHNRWKK 290
gi 229587070 241 VIVHPQLKFEQTGDNKADCYNIMLNINQMLGEWVKQNPAQWFWFHNRWKK 290
gi 157964861 241 VIVHPQLKFEQTGDNKADCYNIMLNINQMLGEWVKQNPSQWFWFHNRWKK 290
gi 67458589  241 VIVHPQLKFEQTGDNKADCYNIMLNINQMLGEWVKQNPSQWFWFHNRWKK 290
gi 238650374 241 VIVHPQLKLEQTGDNKADCYNIMLNINQMLGEWVKQNPAQWFWFHNRWKK 290
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap