Conserved Protein Domain Family
PRK06642

?
PRK06642: PRK06642 
single-stranded DNA-binding protein; Provisional
Statistics
?
PSSM-Id: 135984
View PSSM: PRK06642
Aligned: 13 rows
Threshold Bit Score: 279.683
Threshold Setting Gi: 91204976
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15893218    1 MAGSLNKVILIGNVGRDPEMRTTGEGKKIINLSLATTETWKDRITSERKERTEWHRVVIFSEGLVSVVERYVTKGSKLYI 80
gi 15604667    1 MAGSLNKVILIGNVGRDPEIRTTGEGKKIINLSLATTETWKDRITSERKERTEWHRVVIFSEGLVSIVERYVTKGSKLYI 80
gi 157829131   1 MAGSLNKVILIGNVGRDPEMRTTGEGKKIINLSLATTETWKDRITSERKERTEWHRVVIFSEGLVSVVERYVTKGSKLYI 80
gi 165933856   1 MAGSLNKVILIGNVGRDPEMRTTGEGKKIINLSLATTETWKDRITSERKERTEWHRVVIFSEGLVSVVERYVTKGSKLYI 80
gi 51474004    1 MAGSLNKVILIGNVGRDPEIRTTGEGKKIINLSLATTETWKDRITSERKERTEWHRVVIFSEGLVSIVERYVTKGSKLYI 80
gi 157826305   1 MAGSLNKVILIGNVGRDPEIRTTGEGKKIINLSLATTETWKDRITSERKERTEWHRVVIFSEGLVSVVERYVAKGSKLYI 80
gi 157804225   1 MAGSLNKVILIGNVGRDPEIRTTGEGKKIINLSLATTETWKDRVTGERKERTEWHRVVIFSEGLVSVVERYVTKGSKLYI 80
gi 91204976    1 MAGSLNKVTLIGNLGRDPEIRTTGEGKEIANLSLATTDIWKDRVTGEKKEKTEWHRVVIFNEGLVSVVKNYVKKGSKLYI 80
gi 157827694   1 MAGSLNKVTLIGNLGRDPEIRTTGEGKEIANLSLATTDIWKDRVTGEKKEKTEWHRVVIFNEGLVSVVKNYVKKGSKLYI 80
gi 229587202   1 MAGSLNKVILIGNVGRDPEMRTTGEGKKIINLSLATTETWKDRITSERKERTEWHRVVIFSEGLVSVVERYVTKGSKLYI 80
gi 157964985   1 MAGSLNKVILIGNVGRDPEVRTTGEGKKIINLSLATTETWKDRITSERKERTEWHRVVIFSDGLVSVVERYVTKGSKLYI 80
gi 67459717    1 MAGSLNKVILIGNVGRDPEIRTTGEGKKIINLSLATTETWKDRITSERKERTEWHRVVIFSEGLVSVVERYVTKGSKLYI 80
gi 238650832   1 MAGSLNKVILIGNVGRDPEMRTTGEGKKIINLSLATTETWKDRITSERKERTEWHRVVIFSEGLVSVVERYVTKGSKLYI 80
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 15893218   81 EGSLQTRKWNDNSGQEKYTTEVVLQNFNSQLILLDSKNSNNHN-QDSGHSEYKHPETKNHSFDHSDLDDEIPF 152
gi 15604667   81 EGSLQTRKWNDNSGQEKYTTEVVLQNFNSQLILLDHKNSNQNT-QGSGHHEYKYPETKNHSFDHSDLDDEIPF 152
gi 157829131  81 EGSLQTRKWNDNSGQEKYTTEVVLQNFNSQLILLDSKNSNNHN-QDSGHSEYKHPEIKNHSFDHSDLDDEIPF 152
gi 165933856  81 EGSLQTRKWNDNSGQEKYTTEVVLQNFNSQLILLDSKNSNNHN-QDSGHSEYKHPETKNHSFDHSDLDDEIPF 152
gi 51474004   81 EGSLQTRKWNDNSGQEKYTTEVVLQNFNSQLILLDNKNSNNHT-QGSGHNEYKYPEIKNHSFDHSDLDDEIPF 152
gi 157826305  81 EGSLQTRKWNDNSGQEKYTTEVVLQNFNSQLILLDSKNSNNHN-QDSGHSEYKHTETKNHSFDHSDLDDEIPF 152
gi 157804225  81 EGSLQTRKWNDNSGQEKYTTEVVLQNFNAQLILLDSKNSNNHT-QDSGHNEYKYPETKNHSFDHSDLDDEIPF 152
gi 91204976   81 EGSLQTRKWNDSSGVEKYTTEIVLQNFNSQLILLDSKNSTSSSlQDSGHSEYKHSKP---SFDHSDLDDEIPF 150
gi 157827694  81 EGSLQTRKWNDSSGVEKYTTEIVLQNFNSQLILLDSKNSTSSSlQDSGHSEYKHSKP---SFDHSDLDDEIPF 150
gi 229587202  81 EGSLQTRKWNDNSGQEKYTTEVVLQNFNSQLILLDSKNSNNHN-QDSGHSEYKHPETKNHSFDHSDLDDEIPF 152
gi 157964985  81 EGSLQTRKWNDNSGQEKYTTEVVLQNFNSQLILLDSKNSNNHT-QDSGHSEYKHPETKNHSFDHSDLDDEIPF 152
gi 67459717   81 EGSLQTRKWNDNSGQEKYTTEVVLQNFNSQLILLDSKNSNNHT-QDSGRSEYKHPEAKNHSFDHSDLDDEIPF 152
gi 238650832  81 EGSLQTRKWNDNSGQEKYTTEVVLQNFNSQLILLDSKNSNNHN-QDSGHSEYKHPETKNHSFDHSDLDDEIPF 152
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap