Conserved Protein Domain Family
PRK06646

?
PRK06646: PRK06646 
DNA polymerase III subunit chi; Provisional
Statistics
?
PSSM-Id: 102480
View PSSM: PRK06646
Aligned: 13 rows
Threshold Bit Score: 272.617
Threshold Setting Gi: 157826359
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15893269    1 MQQFSIYQTSDELLLKSILLLIEKCYHSDLKSVILTADADQQEMLNKNLWTYSRKQFIPHGSKLDPQPEKQPIYITDELQ 80
gi 161729084   1 MQQFSIYHTSNELFLKAILRLIEKCYYSNFKSVILTTDVHQQEMLNKNLWTYSRKQFIPHGSKFDPQPAKQPIYITDELQ 80
gi 157829183   1 MQQFSIYQTSDELLLKSILLLIEKCYHSDLKSVILTADADQQEMLNKNLWTYSRKQFIPHGSKLDPQPEKQPIYITDELQ 80
gi 165933911   1 MQQFSIYQTSDELLLKSILLLIEKCYHSDLKSVILTADADQQEMLNKNLWTYSRKQFIPHGSKLDPQPEKQPIYITDELQ 80
gi 51474041    1 MQQFSIYHTSDELLLKAILCLLEKCYYSDLKSVILTTDVDQQEMLNKNLWTYSRKQFIPHGSKFDPQPTKQPIYITDELQ 80
gi 157826359   1 MQQFSIYQTSDELLLKSILLLIEKCYHYDLKSVILTTDADQQEMLNKHLWTYSRKQFIPHGSKLDPQPEKQPIYITDELQ 80
gi 157804263   1 MQQFSIYQTSDELLLKSVLLLIEKCYYSDLKSVILTTDKEQQEMLNKNLWTYSRKQFIPHGSKLDPQPEKQPIYITDELQ 80
gi 91206236    1 MQQFSIYQTSDELLLKAIFLLIEKCYYSDLKSVVLTVDTEQQEMLNKNLWTYSRKQFIPHGSKVDPQPEKQPIYITDTLQ 80
gi 157827852   1 MQQFSIYQTSDELLLKAIFLLIEKCYYSDLKSVVLTVDTEQQEMLNKNLWTYSRKQFIPHGSKVDPQPEKQPIYITDTLQ 80
gi 229587243   1 MQQFSIYQTSDELLLKSILLLIEKCYHSDLKSVILTADADQQEMLNKNLWTYSRKQFIPHGSKLDPQPEKQPIYITDELQ 80
gi 157965013   3 MQQFSIYQTSDELLLKSILLLIEKCYYSDLKSVILTADADQQEMLNKNLWTYSRKQFIPHGSKLDPQPEKQPIYITDELQ 82
gi 67459767    1 MQQFSIYQTSDELLLKSILLLIEKCYRSDLKSVILTADADQQEMLNKNLWTYSRKQFIPHGSKLDPQPEKQPIYITDELQ 80
gi 238651118   1 MQQFSIYQTSDELLLKSILLLIEKCYHSDLKSVILTADADQQEMLNKNLWTYSRKQFIPHGSKLDPQPEKQPIYITDELQ 80
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 15893269   81 NPNNASVLVIISPTDIGKILQAKEYIRVFKRIIIITDLPEDLKELTVKINKFTGQENKIDCFTQNPRGAWNKVV 154
gi 161729084  81 NPNNASVLVIISPTDIAKILQVKEYIKVFKRIIIITDLLENLKELIIKINKFTGQENKIDCFTQNPIGTWNKIA 154
gi 157829183  81 NPNNASVLVIISPTDIGKILQAKEYIRVFKRIIIITDLPEDLKELTVKINKFTEQENKIDCFTQNPRGAWNKVV 154
gi 165933911  81 NPNNASVLVIISPTDIGKILQAKEYIRVFKRIIIITDLPEDLKELTVKINKFTEQENKIDCFTQNPRGAWNKVV 154
gi 51474041   81 NPNNASVLIIISPTDIEKILQVKEYIRVFKRIIIITDLPEDLKQLIIKINKFTGQENKIDCFTQNPMGAWNKIA 154
gi 157826359  81 NPNNASVLIIISPTAIEKILQIKDYVEVFKRIIIITDSPEDLKELTVKINKFTEQENKIDCFTQNLRGTWNKVE 154
gi 157804263  81 NPNNASVLIIISPIDIGKILQVKDYIEVFKRIIIITHFLEDLKELTVKVNKFTEQENKIDCFKQDMRGAWNKVK 154
gi 91206236   81 NPNNASVLIIISPTNIEKILQAKEYVSDFKRIIIITYLPEDLKKLNLKINQITKQENTIDCFTQDQRGSWNKI- 153
gi 157827852  81 NPNNASVLIIISPTNIEKILQAKEYVSDFKRIIIITYLPEDLKKLNLKINQITKQENTIDCFTQDQRGSWNKI- 153
gi 229587243  81 NPNNASVLVIISPTDIGKILQAKEYIRVFKRIIIITDLPEDLKELTVKINKFTGQENKIDCFTQNPRGAWNKVV 154
gi 157965013  83 NPNNASVLVIISPTDIGKILQAKEYIRVFKRIIIITDLPEDLKELTVKINKFTGQENKIDCFTQNPRGAWSKVV 156
gi 67459767   81 NPNNASVLVIISPTDIGKILQAKEYIRVFKRIIIITDLPEDLKELTAKINKFTEQENKIDCFTQNLRGTWNKVE 154
gi 238651118  81 NPNNASVLVIISPTDIGKILQAKEYIRVFKRIIIITDLPEDLKELTVKINKFTGQENKIDCFTQNPRGAWNKVV 154
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap