Conserved Protein Domain Family
PRK06673

?
PRK06673: PRK06673 
DNA polymerase III subunit beta; Validated
Statistics
?
PSSM-Id: 135998
View PSSM: PRK06673
Aligned: 19 rows
Threshold Bit Score: 702.965
Threshold Setting Gi: 218897702
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30262664    1 MEFIVNHKHFTQALSDVSKAISTKAIIPILSGIKITADQSGITLIASNSNIFIEKFIPSAIDDEQITTILQAGTIVVPAK 80
gi 229604660   1 MEFIVNHKHFTQALSDVSKAISTKAIIPILSGIKITADQSGITLIASNSNIFIEKFIPSAIDDEQITTILQAGTIVVPAK 80
gi 42781777    1 MEFIVNHKHFTQALSEVSKAISTKAFIPILSGIKITANQSGITLIASNSNIFIEKFIPSSMDDEQITTTLQAGTIVVPAK 80
gi 30020817    1 MEFIVNHKQFTQALSEVNKAISTKFLIPILSGIKITADQSGITLIASNSNIFIEKFIPVLIEDEKIATILKAGTIVVPAK 80
gi 222096204   1 MEFIVNHKHFTQALSEVSKAISTKAIIPILSGIKITADQSGITLIASNSNIFIEKFIPSSMDDEQITTTLKAGTIVVPAK 80
gi 218897702   1 MEFIVNHKQFTQALSEVNKAISTKSLIPILSGIKITADQSGITLIASNSNIFIEKFIPVSIEDEKIATILKAGTIVVPAK 80
gi 218233276   1 MEFIVNHKQFTQALSEVNKAISTKSLIPILSGIKITADQSGITLIASNSNIFIEKFIPVLIEDEKIATILKAGTIVVPAK 80
gi 217960140   1 MEFIVNHKHFTQALSEVSKAISTKAIIPILSGIKITADQSGITLIASNSNIFIEKFIPSSMDDEQITTTLKAGTIVVPAK 80
gi 301054217   1 MEFIVNHKHFTQALSDVSKAISTKAIIPILSGIKITADQSGITLIASNSNIFIEKFIPSAIDDEQITTILQVGTIVVPAK 80
gi 296503248   1 MEFIVNHKQFTQALSEVNKAISTKSLIPILSGIKITADQSGITLIASNSNIFIEKFIPVLIEDEKIATILKAGTIVVPAK 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30262664   81 YFIEIIKKMPSDIVIKSKNEQTITIQSGEITLNLNGFPANEFPNVPQIDDHTEIQIETKQLIDAFKQTVFAVAKNESRHV 160
gi 229604660  81 YFIEIIKKMPSDIVIKSKNEQTITIQSGEITLNLNGFPANEFPNVPQIDDHTEIQIETKQLIDAFKQTVFAVAKNESRHV 160
gi 42781777   81 YFIEIIKKMPSDIVIKSKNEQTITIQSEEITLNLNGFPASEFPNVPQIEDHAEIQIETKQLIDAFKQTVFAVAKNESRPV 160
gi 30020817   81 YFIEIIKKMPSDIAIKSKNEQIIKIQSEEITLSLNGFPADEFPNVPLIDNHAEIKVETEQLIEVFKQTVFAVAKNESRPV 160
gi 222096204  81 YFIEIIKKMPSDIVIKSKNEQTITIQSEEITLNLNGFPANEFPNVPQIDDHAEIQIETKQLIDAFKQTVFAVAKNESRPV 160
gi 218897702  81 YFIEIIKKMPSDIAIKSKNEQIIKIQSEEITLSLNGFPADEFPNVPLIDNHAEIKVETEQLIEVFKQTVFAVAKNESRPV 160
gi 218233276  81 YFIEIIKKMPSDIAIKSKNEQLITIQSEEIILSLNGFPADEFPNVPLIDNHAEIKVETEQLIEVFKQTVFAVAKNESRPV 160
gi 217960140  81 YFIEIIKKMPSDIVIKSKNEQTITIQSEEITLNLNGFPANEFPNVPQIDDHAEIQIETKQLIDAFKQTVFAVAKNESRPV 160
gi 301054217  81 YFIEIIKKMPSDIVIKSKNEQTITIQSGEITLNLNGFPVNEFPNVPQIDDHTEIQIETKQLIDAFKQTVFAVAKNESRPV 160
gi 296503248  81 YFIEIIKKMPSDIAIKSKNEQIIKIQSEEITLSLNGFPADEFPNVPLIDNHAEIKVETEQLIEVFKQTVFAVAKNESRPV 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30262664  161 LTGVHIELDHNKLICAATDSHRLAIRETLISTNMKANCIVPSATINELLKLMNSNLEFVSIYLSESHIIFTFGTTTLYSR 240
gi 229604660 161 LTGVHIELDHNKLICAATDSHRLAIRETLISTNMKANCIVPSATINELLKLMNSNLEFVSIYLSESHIIFTFGTTTLYSR 240
gi 42781777  161 LTGVHIELDYNKLICAATDSHRLAIRETQISTNMKANCIVPSATINELLKLMNSNLEFVSIYLSESHIIFTFGTTTLYSR 240
gi 30020817  161 LTGVHIELSNNKLICAATDSHRLAIRETLLSSDVKANCIVPSATINELLKLMNSNSEFVYIYFSESHIIFTFGTTTLYSR 240
gi 222096204 161 LTGVHIELDHNKLICAATDSHRLAIRETLISTNMKANCIVPSATINELLKLMNSNLEFVSIYLSESHIIFTFGTTTLYSR 240
gi 218897702 161 LTGVHIELSNNKFICAATDSHRLAIRETRLSSDVKANCIVPSATISELLKLMNSNSEFVYIYLSESHIIFTLGTTTLYSR 240
gi 218233276 161 LTGVHIELSNNKLICAATDSHRLAIRETLLSSDVKANCIVPSATISELLKLMNSNSEFVYIYLSESHIIFTLGTTTLYSR 240
gi 217960140 161 LTGVHIELDHNKLICAATDSHRLAIRETLISTNMKANCIVPSATINELLKLMNSNLEFVSIYLSESHIIFTFGTTTLYSR 240
gi 301054217 161 LTGVHIELDHNKLICAATDSHRLAIRETLISTNMKANCIVPSATINELLKLMNSNLEFVSIYLSESHIIFTFGTTTLYSR 240
gi 296503248 161 LTGVHIELSNNKFICAATDSHRLAIRETRLSSDVKANCIVPSATINELLKLMNSNSKFVYIYLSESHIIFTLGTTTLYSR 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30262664  241 LIEGKYPNISTLIPNEFQTVINIDRQRMLQGVDRSSLLASEWANNNVNLEIVNESTIQISSNASQIGKISEKQQIDVIQG 320
gi 229604660 241 LIEGKYPNISTLIPNEFQTVINIDRQRMLQGVDRSSLLASEWANNNVNLEIVNESTIQISSNASQIGKISEKQQIDVIQG 320
gi 42781777  241 LIEGKYPNISSLIPNEFQTVINVDRQRMLQGVDRSSLLASEWANNNVNLEIVNESTIKVSSNASQIGKIYETQQVDAIHG 320
gi 30020817  241 LIEGKYPNISNLIPNDFKTIINVDRKKILQGVDRSSLLASEWANNNVNLEIINESTIKISSNASQIGKISETQQIDAIQG 320
gi 222096204 241 LIEGKYPNISTLIPNEFQTVINIDRQRMLQGVDRSSLLASEWANNNVNLEIVNESTIQISSNASQIGKISETQQIDAIQG 320
gi 218897702 241 LIEGKYPNISNLIPNDFKTIINIDRKKILQGVDRSSLLASEWANNNVNLEIINESTIKISSNASQIGQISETQQIDAIQG 320
gi 218233276 241 LIEGKYPNISNLIPNDFKTIINIDRKKVLQGVDRSSLLASEWANNNVNLEIINESTIKISSNASQIGQISETQQIDAIQG 320
gi 217960140 241 LIEGKYPNISTLIPNEFQTVINIDRQRMLQGVDRSSLLASEWANNNVNLEIVNESTIQISSNASQIGKISETQQIDAIQG 320
gi 301054217 241 LIEGKYPNISTLIPNEFQTVINIDRQRMLQGVDRSSLLASEWANNNVNLEIVNESTIQISSNASQIGKISETQQIDGLQG 320
gi 296503248 241 LIEGKYPNISNLIPNDFKTIINVDRKKILQGVDRSSLLASEWANNNVNLEIINESTIKISSNASQIGKISETQQIDAIQG 320
                        330       340       350       360       370
                 ....*....|....*....|....*....|....*....|....*....|....*.
gi 30262664  321 KKQLNISFDGRFMLDALRAIKEETVTLSFSGSMRPILIEAGTQSAAIHLISPVRAY 376
gi 229604660 321 KKQLNISFDGRFMLDALRAIKEETVTLSFSGSMRPILIEAGTQSAAIHLISPVRAY 376
gi 42781777  321 EKQLHISFDGRFMLDALRAIKEETVTLSFSGSMRPILIEAGTQSAAIHLISPVRAY 376
gi 30020817  321 EKQLNISFDGRFMVDALRAIKEETITLSFGGSMRPILIEAGEQSAAVHLISPVRAY 376
gi 222096204 321 EKQFNISFDGRFMLDALRAIKEETVTLSFSGSMRPILIEAGTQCAAIHLISPVRAY 376
gi 218897702 321 EKQLNISFDGRFMVDALRAIKEETITLSFGGSMRPILIEAGEQSAAIHLISPVRAY 376
gi 218233276 321 EKQLNISFDGRFMVDALRAIKEEKITLSFGGSMRPILIEAGEQSAAVHLISPVRAY 376
gi 217960140 321 EKQFNISFDGRFMLDALRAIKEETVTLSFSGSMRPILIEAGTQCAAIHLISPVRAY 376
gi 301054217 321 EKQLNISFDGRFMVEALKAIKEETITLSFGGSMRPILIEAGEQSAVVHLISPVRAY 376
gi 296503248 321 EKQLNISFDGRFMVDALRAIKEETITLSFGGSMRPILIEAGEQSAAVHLISPVRAY 376
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap