Conserved Protein Domain Family
PRK06683

?
PRK06683: PRK06683 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 136002
View PSSM: PRK06683
Aligned: 20 rows
Threshold Bit Score: 135.206
Threshold Setting Gi: 163938112
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30018374   6 MSYQKVSTAENVVVGHKRTLEAIKNGTVKEVVIAEDADMRLTHAIIRIAMQYNVPITKVESVRKLGKASGIQVGASAIGI 85
gi 163938112  1 MSYQKVSNAENVVVGHKRTLEAIKNGIVKEVVIAEDADVRLTHVIIRTALQHNIPITKVESVRKLGKVSGIQVGASAIGI 80
gi 218232073  1 MSYQKVSTAENVVVGHKRTLEAIKNGTVKEVVIAEDADMRLTHAIIRFAMQYNVPITKVESVRKLGKASGIQVGASAIGI 80
gi 218901308  1 MSYQKVSNAENVVVGHKRTLEAIKNGIVKEVVIAEDADMRLTHVIIRTALQHNIPITKVESVRKLGKVAGIQVGASAIGI 80
gi 218895239  1 MSYQKVSNAENVVVGHKRTLEAIKNGIVKEVVIAEDADVRLTHVIIRTALQHNIPITKVESVRKLGKVSGIQVGASAIGI 80
gi 222093874 12 MSYQKVSNAENVVVGHKRTLEAIKNGIVKEVVIAEDADMRLTHVIIRTALQHNIPITKVESVRKLGKVAGIQVGASAIGI 91
gi 227812777  1 MSYQKVSNAENVVVGHKRTLEAIKNGIVKEVVIAEDADMRLTHVIIRTALQHNIPITKVESVRKLGKVAGIQVGASAIGI 80
gi 225862156  1 MSYQKVSNAENVVVGHKRTLEAIKNGIVKEVVIAEDADMRLTHVIIRTALQHNIPITKVESVRKLGKVAGIQVGASAIGI 80
gi 229604152  1 MSYQKVSNAENVVVGHKRTLEAIKNGIVKEVVIAEDADMRLTHVIIRTALQHNIPITKVESVRKLGKVAGIQVGASAIGI 80
gi 301051841  1 MSYQKVSNAENVVVGHKRTLEAIKNGIVKEVVIAEDADMRLTHVIIRTALQHNIPITKVESVRKLGKVAGIQVGASAIGI 80

                ..
gi 30018374  86 IS 87
gi 163938112 81 IS 82
gi 218232073 81 IS 82
gi 218901308 81 IS 82
gi 218895239 81 IS 82
gi 222093874 92 IS 93
gi 227812777 81 IS 82
gi 225862156 81 IS 82
gi 229604152 81 IS 82
gi 301051841 81 IS 82
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap