Conserved Protein Domain Family
PRK06702

?
PRK06702: PRK06702 
O-acetylhomoserine aminocarboxypropyltransferase; Validated
Statistics
?
PSSM-Id: 102505
View PSSM: PRK06702
Aligned: 20 rows
Threshold Bit Score: 814.673
Threshold Setting Gi: 30023436
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30265427    1 MGESWGKGTICVQGGYTPKNGEPRVLPLYQSTTYKYDTSDDLAALFNLEAEGYIYTRIGNPTLAAFEQKLAELEGGVGAV 80
gi 42784580    1 MGESWGKGTICVQGGYTPKNGEPRVLPLYQSTTYKYDTSDDLAALFNLEAEGYIYTRIGNPTLAAFEQKLADLEGGVGAV 80
gi 30023436    1 -----------MQGGYTPKNGEPRVLPLYQSTTYKYDTSDDLAALFNLEAEGYIYTRIGNPTLAAFEQKLSDLEGGVGAV 69
gi 222098879   1 MGESWGKGTICVQGGYTPKNGEPRVLPLYQSTTYKYDTSDDLAALFNLEAEGYIYTRIGNPTLAAFEQKLADLEGGVGAV 80
gi 218900533   1 MGESWGKGTICVQGGYTPKNGEPRVLPLYQSTTYKYDTSDDLAALFNLEAEGYIYTRIGNPTLAAFEQKLSDLEGGVGAV 80
gi 218234453   1 MGESWGKGTICVQGGYTPKNGEPRVLPLYQSTTYKYDTSDDLAALFNLEAEGYIYTRIGNPTLAAFEQKLSDLEGGVGAV 80
gi 217962896   1 MGESWGKGTICVQGGYTPKNGEPRVLPLYQSTTYKYDTSDDLAALFNLEAEGYIYTRIGNPTLAAFEQKLADLEGGVGAV 80
gi 118480438   1 MGESWGKGTICVQGGYTPKNGEPRVLPLYQSTTYKYDTSDDLAALFNLEAEGYIYTRIGNPTLAAFEQKLAELEGGVGAV 80
gi 296505828   1 MGESWGKGTICVQGGYTPKNGEPRVLPLYQSTTYKYDTSDDLAALFNLEAEGYIYTRIGNPTLAAFEQKLSDLEGGVGAV 80
gi 49480445    1 MGESWGKGTICVQGGYTPKNGEPRVLPLYQSTTYKYDTSDDLAALFNLEAEGYIYTRIGNPTLAAFEQKLAELEGGVGAV 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30265427   81 ATASGQAAIMLAVLNICSSGDHLLCSSTVYGGTFNLFGVSLRKLGIDVTFFNPNLTADEIVALANDKTKLVYAESLGNPA 160
gi 42784580   81 ATASGQAAIMLAVLNICSSGDHLLCSSTVYGGTFNLFGVSLRKLGIDVTFFNPNLTADEIVALANDKTKLVYAESLGNPA 160
gi 30023436   70 ATASGQAAIMLAVLNICSSGDHLLCSSTVYGGTFNLFGVSLRKLGIDVTFFNPNLTADEITALANDKTKLIYAESLGNPA 149
gi 222098879  81 ATASGQAAIMLAVLNICSSGDHLLCSSTVYGGTFNLFGVSLRKLGIDVTFFNPNLTADEIVALANDKTKLVYAESLGNPA 160
gi 218900533  81 ATASGQAAIMLAVLNICSSGDHLLCSSTVYGGTFNLFGVSLRKLGIDVTFFNPNLTADEIAALANDKTKLIYAESLGNPA 160
gi 218234453  81 ATASGQAAIMLAVLNICSSGDHLLCSSTVYGGTFNLFGVSLRKLGIDVTFFNPNLTADEITALANDKTKLIYAESLGNPA 160
gi 217962896  81 ATASGQAAIMLAVLNICSSGDHLLCSSTVYGGTFNLFGVSLRKLGIDVTFFNPNLTADEIVALANDKTKLVYAESLGNPA 160
gi 118480438  81 ATASGQAAIMLAVLNICSSGDHLLCSSTVYGGTFNLFGVSLRKLGIDVTFFNPNLTADEIVALANDKTKLVYAESLGNPA 160
gi 296505828  81 ATASGQAAIMLAVLNICSSGDHLLCSSTVYGGTFNLFGVSLRKLGIDVTFFNPNLTTDEITALANDKTKLIYAESLGNPA 160
gi 49480445   81 ATASGQAAIMLAVLNICSSGDHLLCSSTVYGGTFNLFGVSLRKLGIDVTFFNPNLTADEIVALANDKTKLVYAESLGNPA 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30265427  161 MNVLNFKEFSDAAKELEVPFIVDNTLATPYLCQAFEHGANIIVHSTTKYIDGHASSLGGIVIDGGNFDWTNGKYPELVEP 240
gi 42784580  161 MNVLNFKELSDAAKELEVPFIVDNTLATPYLCQAFEHGANIIVHSTTKYIDGHASSLGGIVIDGGNFDWTNGKYPELVEP 240
gi 30023436  150 MNVLNFKEFSAAAKELEVPFIVDNTLATPYLCQAFEYGANIIVHSTTKYIDGHASSLGGIVIDGGNFDWTNGKYPELVEP 229
gi 222098879 161 MNVLNFKELSDAAKELEVPFIVDNTLATPYLCQAFEHGANIIVHSTTKYIDGHASSLGGIVIDGGNFDWTNGKYPELVEP 240
gi 218900533 161 MNVLNFKEFSDAAKELEVPFIVDNTLATPYLCQAFEHGANIIVHSTTKYIDGHASSLGGIVIDGGNFDWTNGKYPELVEP 240
gi 218234453 161 MNVLNFKEFSAAAKELEVPFIVDNTLATPYLCQAFEHGANIIVHSTTKYIDGHASSLGGIVIDGGNFDWTNGKYPELVEP 240
gi 217962896 161 MNVLNFKELSDAAKELEVPFIVDNTLATPYLCQAFEHGANIIVHSTTKYIDGHASSLGGIVIDGGNFDWTNGKYPELVEP 240
gi 118480438 161 MNVLNFKEFSDAAKELEVPFIVDNTLATPYLCQAFEHGANIIVHSTTKYIDGHASSLGGIVIDGGNFDWTNGKYPELVEP 240
gi 296505828 161 MNVLNFKEFSAAAKELEVPFIVDNTLATPYLCQAFEHGANIIVHSTTKYIDGHASSLGGIVIDGGNFDWTNGKYPELVEP 240
gi 49480445  161 MNVLNFKEFSDAAKELEVPFIVDNTLATPYLCQAFEHGANIIVHSTTKYIDGHASSLGGIVIDGGNFDWTNGKYPELVEP 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30265427  241 DPSYHGVSYVQNFGAAAYIVKARVQLLRDYGNCMSPFNAYISNIGLETLHLRMERHSENALAVAKWLADHERIEWVNYPG 320
gi 42784580  241 DPSYHGVSYVQNFGAAAYIVKARVQLLRDYGNCMSPFNAYISNIGLETLHLRMERHSENALAVAKWLADHERIEWVNYPG 320
gi 30023436  230 DPSYHGVSYVQNFGAAAYIVKARVQLLRDYGNCMSPFNAYISNIGLETLHLRMERHSENALAVAKWLANHERIEWVNYPG 309
gi 222098879 241 DPSYHGVSYVQNFGAAAYIVKARVQLLRDYGNCMSPFNAYISNIGLETLHLRMERHSENALAVAKWLADHERIEWVNYPG 320
gi 218900533 241 DPSYHGVSYVQNFGAAAYIVKARVQLLRDYGNCMSPFNAYISNIGLETLHLRMERHSENALVVAKWLANHERIEWVNYPG 320
gi 218234453 241 DPSYHGVSYVQNFGAAAYIVKARVQLLRDYGNCMSPFNAYISNIGLETLHLRMERHSENALAVAKWLANHERIEWVNYPG 320
gi 217962896 241 DPSYHGVSYVQNFGAAAYIVKARVQLLRDYGNCMSPFNAYISNIGLETLHLRMERHSENALAVAKWLADHERIEWVNYPG 320
gi 118480438 241 DPSYHGVSYVQNFGAAAYIVKARVQLLRDYGNCMSPFNAYISNIGLETLHLRMERHSENALAVAKWLADHERIEWVNYPG 320
gi 296505828 241 DPSYHGVSYVQNFGAAAYIVKARVQLLRDYGNCMSPFNAYISNIGLETLHLRMERHSENALAVAKWLANHERIEWVNYPG 320
gi 49480445  241 DPSYHGVSYVQNFGAAAYIVKARVQLLRDYGNCMSPFNAYISNIGLETLHLRMERHSENALAVAKWLADHGRIEWVNYPG 320
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30265427  321 LDSNENYSLAQKYLKKGASGVLTFGIKGGLEAAKEFIANVKLATLVTHVADARTCVIHPASTTHRQLSAEDQRLAGVTSD 400
gi 42784580  321 LDSNENYSLAQKYLKRGASGVLTFGIKGGLEAAKEFIANVKLATLVTHVADARTCVIHPASTTHRQLSAEDQRLAGVTSD 400
gi 30023436  310 LDSNENYSLAQQYLKKGASGVLTFGIKGGLEAAKEFIANVKLATLVTHVADARTCVIHPASTTHRQLNAEDQRLAGVTSD 389
gi 222098879 321 LNSNENYSLAQKYLKKGASGVLTFGIKGGLEAAKEFISNVKLATLVTHVADARTCVIHPASTTHRQLSAEDQRLAGVTSD 400
gi 218900533 321 LDSNENYSLAQTYLKKGASGVLTFGIKGGLEAAKEFIANVKLATLVTHVADARTCVIHPASTTHRQLSAEDQRLAGVTSD 400
gi 218234453 321 LDSNENYSLAQQYLKKGASGVLTFGIKGGLEAAKEFIANVKLATLVTHVADARTCVIHPASTTHRQLNAEDQRLAGVTSD 400
gi 217962896 321 LNSNENYSLAQKYLKKGASGVLTFGIKGGLEAAKEFISNVKLATLVTHVADARTCVIHPASTTHRQLSAEDQRLAGVTSD 400
gi 118480438 321 LDSNENYSLAQKYLKKGASGVLTFGIKGGLEAAKEFIANVKLATLVTHVADARTCVIHPASTTHRQLSAEDQRLAGVTSD 400
gi 296505828 321 LDSNENYSLAQQYLKKGASGVLTFGIKGGLEAAKEFIANVKLATLVTHVADARTCVIHPASTTHRQLNAEDQRLAGVTSD 400
gi 49480445  321 LDSNENYSLAQKYLKKGASGVLTFGIKGGLEAAKEFIANVKLATLVTHVADARTCVIHPASTTHRQLSAEDQRLAGVTSD 400
                        410       420       430
                 ....*....|....*....|....*....|..
gi 30265427  401 LIRLSVGIEDVSDIIADLEAALVGGKQHADHN 432
gi 42784580  401 LIRLSVGIEDVSDIIADLEAALVGGKQHADHN 432
gi 30023436  390 LIRLSVGIEDVSDIIADLEAALVGGKTHANHN 421
gi 222098879 401 LIRLSVGIEDVSDIIADLEAALVGGKQHADHN 432
gi 218900533 401 LIRLSVGIEDVSDIIADLEAALVGGKEHADHN 432
gi 218234453 401 LIRLSVGIEDVSDIIADLEAALVGGKTHADHN 432
gi 217962896 401 LIRLSVGIEDVSDIIADLEAALVGGKQHADHN 432
gi 118480438 401 LIRLSVGIEDVSDIIADLEAALVGGKQHADHN 432
gi 296505828 401 LIRLSVGIEDVSDIIADLEAALVGGKTHADHN 432
gi 49480445  401 LIRLSVGIEDVFDIIADLEAALVGGKQHADHN 432
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap