Conserved Protein Domain Family
PRK06721

?
PRK06721: PRK06721 
threonine synthase; Reviewed
Statistics
?
PSSM-Id: 136018
View PSSM: PRK06721
Aligned: 20 rows
Threshold Bit Score: 621.322
Threshold Setting Gi: 218896954
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30261998    1 MYKGLLNQYASYLPVNENTPDVSLMEGNTPLIPLLNISKQLGIQLYGKYEGANPTGSFKDRGMVMAVAKAKEEGSEAIIC 80
gi 42781120    1 MYKGLLKQYASYLPVNENTPDVSLMEGNTPLIPLLNISKQLGIQLYGKYEGANPTGSFKDRGMVMAVAKAKEEGSEAIIC 80
gi 30020104    1 MYKGLLKQYASYLPVNENTPDVSLMEGNTPLIPLLNISKQLGIQLYGKYEGANPTGSFKDRGMVMAVAKAKEEGSEAIIC 80
gi 222095618   1 MYKGLLNEYASYLPVNENTPDVSLMEGNTPLIPLLNISKQLGIQLYGKYEGANPTGSFKDRGMVMAVAKAKEDGSEAIIC 80
gi 218896954   1 MYKGLLKQYASYLPVNEKTPDVSLMEGNTPLIPLLNISKQLGVQLYGKYEGANPTGSFKDRGMVMAVAKAKEEGSEAIIC 80
gi 218234635   1 MYKGLLKQYASYLPVNENTPDVSLMEGNTPLIPLLNISKQLGIQLYGKYEGANPTGSFKDRGMVMAVAKAKEEGSEAIIC 80
gi 217959475   1 MYKGLLNEYASYLPVNENTPDVSLMEGNTPLIPLLNISKQLGIQLYGKYEGANPTGSFKDRGMVMAVAKAKEEGSEAIIC 80
gi 225863927   1 MYKGLLKQYASYLPVNENTPDVSLMEGNTPLIPLLNISNQLGIQLYGKYEGANPTGSFKDRGMVMAVAKAKEEGSEAIIC 80
gi 118477422   7 MYKGLLKQYASYLPVNENTPDVSLMEGNTPLIPLLNISNQLGIQLYGKYEGANPTGSFKDRGMVMAVAKAKEEGSEAIIC 86
gi 163939811   1 MYKGLLKQYVSYLPVNENTPDVSLMEGNTPLIPLLNISKQLGIQLYGKYEGANPTGSFKDRGMVMAVAKAKEEGAEAIIC 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30261998   81 ASTGNTSASAAAYAARLGMKCIIVIPEGKIAHGKLAQAVAYGAEIISIEGNFDDALKAVRNIAEEEPITLVNSVNPYRIE 160
gi 42781120   81 ASTGNTSASAAAYAARLGMKCIIVIPEGKIAHGKLAQAVAYGAEIISIEGNFDDALKAVRNIAAEEPITLVNSVNPYRIE 160
gi 30020104   81 ASTGNTSASAAAYAARLGMKCIIVIPEGKIAHGKLAQAVAYGAEIISIEGNFDDALKAVRNIAAEEPITLVNSVNPYRIE 160
gi 222095618  81 ASTGNTSASAAAYAARLGMKCIIVIPEGKIAHGKLAQAVAYGAEIISIEGNFDDALKAVRNIAAEEPITLVNSVNPYRIE 160
gi 218896954  81 ASTGNTSASAAAYAARLGMKCIIVIPEGKIAHGKLAQAVAYGAEIISIEGNFDDALKAVRNIAAEEPITLVNSVNPYRIE 160
gi 218234635  81 ASTGNTSASAAAYAARLGMKCIIVIPEGKIAHGKLAQAVAYGAEIISIEGNFDDALKAVRNIAAEEPITLVNSVNPYRIE 160
gi 217959475  81 ASTGNTSASAAAYAARLGMKCIIVIPEGKIAHGKLAQAVAYGAEIISIEGNFDDALKAVRNIAAEEPITLVNSVNPYRIE 160
gi 225863927  81 ASTGNTSASAAAYAARLGMKCIIVIPEGKIAHGKLAQAVAYGAEIISIEGNFDDALKAVRNIAAEEPITLVNSVNPYRIE 160
gi 118477422  87 ASTGNTSASAAAYAARLGMKCIIVIPEGKIAHGKLAQAVAYGAEIISIEGNFDDALKAVRNIAAEEPITLVNSVNPYRIE 166
gi 163939811  81 ASTGNTSASAAAYAARLGMKCIIVIPEGKIAHGKLAQAVAYGAEIISIEGNFDDALKAVRNIAAEEPITLVNSVNPYRIE 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30261998  161 GQKTAAFEICDQLQRAPDVLAIPVGNAGNITAYWKGFCEYEKEKGYKKPRIHGFEAEGAAAIVKGHVIDEPETIATAIRI 240
gi 42781120  161 GQKTAAFEICDQLQSAPDVLAIPVGNAGNITAYWKGFCEYEKEKGYKKPRIHGFEAEGAAAIVKGHVIDEPETIATAIRI 240
gi 30020104  161 GQKTAAFEICDQLQNAPDVLAIPVGNAGNITAYWKGFCEYEKEKGYKKPRIHGFEAEGAAAIVKGHVIEEPETIATAIRI 240
gi 222095618 161 GQKTAAFEICDQLQSAPDVLAIPVGNAGNITAYWKGFCEYEKEKGYKKPRIHGFEAEGAAAIVKGHVIDEPETIATAIRI 240
gi 218896954 161 GQKTAAFEICDQLQNAPDVLAIPVGNAGNITAYWKGFCEYEKEKGYKKPRIHGFEAEGAAAIVKGHVIEEPETIATAIRI 240
gi 218234635 161 GQKTAAFEICDQLQNAPDVLAIPVGNAGNITAYWKGFCEYEKEKGYKKPRIHGFEAEGAAAIVKGHVIEEPETIATAIRI 240
gi 217959475 161 GQKTAAFEICDQLQRAPDVLAIPVGNAGNITAYWKGFCEYEKEKGYKKPRIHGFEAEGAAAIVKGHVIEEPETIATAIRI 240
gi 225863927 161 GQKTAAFEICDQLQSAPDVLAIPVGNAGNITAYWKGFCEYEKEKGYKKPRIHGFEAEGAAAIVKGQVIEEPETIATAIRI 240
gi 118477422 167 GQKTAAFEICDQLQSAPDVLAIPVGNAGNITAYWKGFCEYEKEKGYKKPRIHGFEAEGAAAIVKGQVIEEPETIATAIRI 246
gi 163939811 161 GQKTAAFEICDQLQNAPDVLAIPVGNAGNITAYWKGFCEYEKEKGYKKPRIHGFEAEGAAAIVKGHVIEAPETIATAIRI 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30261998  241 GNPASWSYAVEAAEQSHGEIDMVSDEEILHAYRLLAKSEGVFAEPGSNASLAGVMKHVQSGKIKKGETVVAVLTGNGLKD 320
gi 42781120  241 GNPASWSYAVEAAEQSHGEIDMVSDEEILHAYRLLAKSEGVFAEPGSNASLAGVMKHVQSGKIKKGETVVAVLTGNGLKD 320
gi 30020104  241 GNPASWSYAVEAAEQSCGEIDMVSDEEILHAYRLLAKTEGVFAEPGSNASLAGVIKHVKSGKIKKGETVVAVLTGNGLKD 320
gi 222095618 241 GNPASWSYAVEAAEQSHGEIDMVSDEEILHAYRLLAKSEGVFAEPGSNASLAGVMKHVQSGKIKKGETVVAVLTGNGLKD 320
gi 218896954 241 GNPASWSYAVEAAEQSCGEIDMVSDEEILYAYRLLAKTEGVFAEPGSNASLAGVIKHVQSGKIKEGETVVAVLTGNGLKD 320
gi 218234635 241 GNPASWSYAVEAAEQSRGEIDMVSDEEILHAYRLLAKTEGVFAEPGSNASLAGVIKHVESGKIKKGETVVAVLTGNGLKD 320
gi 217959475 241 GNPASWSYAVEAAEQSHGEIDMVSDEEILHAYRLLAKSEGVFAEPGSNASLAGVMKHVQSGKIKKGETVVAVLTGNGLKD 320
gi 225863927 241 GNPASWSYAVEAAQQSHGEIDMVSDEEILHAYRLLAKSEGVFAEPGSNASLAGVMKHVQSGKIKKGETVVAVLTGNGLKD 320
gi 118477422 247 GNPASWSYAVEAAQQSHGEIDMVSDEEILHAYRLLAKSEGVFAEPGSNASLAGVMKHVQSGKIKKGETVVAVLTGNGLKD 326
gi 163939811 241 GNPASWSYAVEAAEQSHGEIDMVSDEEILHAYRLLAKTEGVFAEPGSNASLAGVIKHVQSGKIKKGETVVAVLTGNGLKD 320
                        330       340       350
                 ....*....|....*....|....*....|..
gi 30261998  321 PDIAISSNTLDIASVSNNIEQIKEHIKGVIMS 352
gi 42781120  321 PDIAISSNTLDIASVSNNIEQIKEHIKGVIMS 352
gi 30020104  321 PDIAISSNQLDIASLSNDIEQIKDHIKGVIMS 352
gi 222095618 321 PDIAISANTLDIASVSNNIEQIKEHIKGVIMS 352
gi 218896954 321 PDIAISSNQLDIASLSNNIEQIKDHIKGVIMS 352
gi 218234635 321 PDIAISSNQLDIANVSNDIEQIKDHIKGVIMS 352
gi 217959475 321 PDIAISSNTLDIASVSNNIEQIKEHIKGVIMS 352
gi 225863927 321 PDIAISSNTLDIASVSNNIEQIKEHIKGVIMS 352
gi 118477422 327 PDIAISSNTLDIASVSNNIEQIKEHIKGVIMS 358
gi 163939811 321 PDIAISSNKFDIASVSNDIEQIKDHIKGVIMS 352
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap