Conserved Protein Domain Family
PRK06728

?
PRK06728: PRK06728 
aspartate-semialdehyde dehydrogenase; Provisional
Statistics
?
PSSM-Id: 136022
View PSSM: PRK06728
Aligned: 19 rows
Threshold Bit Score: 680.622
Threshold Setting Gi: 42781527
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30262435    1 MSEKGYHLAVVGATGAVGQKIIELLEKETKFNIAEVTLLSSKRSAGKTVQFKGREIIIQEAKINSFEGIDIAFFSAGGEV 80
gi 42781527    1 MSEKGYHVAIVGATGAVGQKIIELLEKETKFNIAEVTLLSSKRSAGKTVQFKGREIIIQEAKINSFEGVDIAFFSAGGEV 80
gi 30020494    1 MIKKGYHVAVVGATGAVGQKIIELLENEMKFNVVEVTLLSSKRSAGKKVRFKGREIIIQEAKTTSFEGVDIAFFSAGGEV 80
gi 222096015   1 MSEKGYHVAVVGATGAVGQKIIELLEKETKFNITEVTLLSSKRSAGKTVQFKGREIIIQEAKINSFEGVDIAFFSAGGEV 80
gi 218897370   1 MIKKGYHVAVVGATGAVGQKIIELLENEMKFNIVEVTLLSSKRSAGKKVRFKGREIIIQEAKTTSFEGVDIAFFSAGGEV 80
gi 217959926   1 MSEKGYHVAVVGATGAVGQKIIELLEKETKFNITEVTLLSSKRSAGKTVQFKGREIIIQEAKINSFEGVDIAFFSAGGEV 80
gi 225864392   1 MSEKGYHVAVVGATGAVGQKIIELLEKETKFNITEVTLLSSKRSAGKTVQFKGRETIIQEAKINSFEGVDIAFFSAGGEV 80
gi 118477826   1 MSEKGYHVAVVGATGAVGQKIIELLEKETKFNITEVTLLSSKRSAGKTVQFKGRETIIQEAKINSFEGVDIAFFSAGGEV 80
gi 296502958   1 MIKKGYHVAVVGATGAVGQKIIELLENEMKFNIVEVTLLSSKRSAGKKVRFKGREIIIQEAKTTSFEGVDIAFFSAGGEV 80
gi 163940205   1 MSEKSYHVAVVGATGAVGQKIIALLERVTKFNIEEITLLSSKRSAGKIVQFKGREIKIQEAKSTSFEGVDIAFFSAGGEV 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30262435   81 SRQFVNQAVSSGAIVIDNTSEYRMAHDVPLVVPEVNTHTLKEHKGIIAVPNCSALQMVTALQPIRKVFGLERIIVSTYQA 160
gi 42781527   81 SRQFVNQAVSSGAIVIDNTSEYRMAPDVPLVVPEVNAHTLKEHKGIIAVPNCSALQMVTALQPIRKVFGLERIIVSTYQA 160
gi 30020494   81 SRQFVTHAVSSGAIVIDNTSEYRMAQGVPLVVPEVNAHTLKQHKGIIAVPNCSALQMVTALQPIRKSFGLERIIVSTYQA 160
gi 222096015  81 SRQFVNQAVSSGAIVIDNTSKYRMAHDVPLVVPEVNAHTLKEHKGIIAVPNCSALQMVTALQPIRKVFGLERIIVSTYQA 160
gi 218897370  81 SRQFVTHAVSSGAIVIDNTSEYRMAQGVPLVVPEVNAHTLERHKGIIAVPNCSALQMVTALQPIRKSFGLERIIVSTYQA 160
gi 217959926  81 SRQFVNQAVSSGAIVIDNTSKYRMAHDVPLVVPEVNAHTLKEHKGIIAVPNCSALQMVTALQPIRKVFGLERIIVSTYQA 160
gi 225864392  81 SRQFVNQVVSSGAIVIDNTSEYRMAHDVPLVVPEVNAHTLKEHKGIIAVPNCSALQMVTALQPIRKVFGLERIIVSTYQA 160
gi 118477826  81 SRQFVNQVVSSGAIVIDNTSEYRMAHDVPLVVPEVNAHTLKEHKGIIAVPNCSALQMVTALQPIRKVFGLERIIVSTYQA 160
gi 296502958  81 SRQFVTHAVSSGAIVIDNTSEYRMAQGVPLVVPEVNAHTLKQHKGIIAVPNCSALQMVTALQPIRKSFGLERIIVSTYQA 160
gi 163940205  81 SRQYVNHAVSSGAIVIDNTSEYRMAHDVPLVVPEVNAHTLREHKRIIAVPNCSALQMVTALQPIRKSFGLERIIVSTYQA 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30262435  161 VSGSGIHAIQELKEQAKSILAGEEVESTILPAKKDKKHYPIAFNVLPQVDIFTDNDFTFEEVKMIQETKKILEDPNLKMA 240
gi 42781527  161 VSGSGIHAIQELKEQAKSILAGEEVESTILPAKKDKKHYPIAFNVLPQVDIFTDNDFTFEEVKMIQETKKILEDPNLKMA 240
gi 30020494  161 VSGSGIHAIHELREQAKSILAGEEVKSDILPVKKDKKHYPIAFNVLPQVDIFTDNDFTFEEVKMIQETKKILEDENLKMA 240
gi 222096015 161 VSGSGIHAIQELKEQAKSILAGEEVESTILPAKKDKKHYPIAFNVLPQVDIFTDNDFTFEEVKMIQETKKILEDPNLKMA 240
gi 218897370 161 VSGSGIHAIHELQEQAKSMLAGKEVKSDILPAKKDKKHYPIAFNVLPQVDIFTDNDFTFEEVKMIQETKKILEDENLKMA 240
gi 217959926 161 VSGSGIHAIQELKEQAKSILAGEEVESTILPAKKDKKHYPIAFNVLPQVDIFTDNDFTFEEVKMIQETKKILEDPNLKMA 240
gi 225864392 161 VSGSGIHAIQELKEQAKSILAGEEVESTILPAKKDKKHYPIAFNVLPQVDIFTDNDFTFEEVKMIQETKKILEDPNLKMA 240
gi 118477826 161 VSGSGIHAIQELKEQAKSILAGEEVESTILPAKKDKKHYPIAFNVLPQVDIFTDNDFTFEEVKMIQETKKILEDPNLKMA 240
gi 296502958 161 VSGSGIHAIHELREQAKSILAGEEVKSDILPVKKDKKHYPIAFNVLPQVDIFTDNDFTFEEVKMIQETKKILEDENLKMA 240
gi 163940205 161 VSGSGIHAIHELKEQAKSMLTGEEVKSTILPVKKDKKHYPIAFNVLPQVDIFTDNDFTFEEVKMIQETKKILEDPNLKMA 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30262435  241 ATCVRVPVISGHSESVYIELEKEATVAEIKEVLFDAPGVILQDNPSEQLYPMPLYAEGKIDTFVGRIRKDPDTPNGFHLW 320
gi 42781527  241 ATCVRVPVVSGHSEAXYIELEKEVTVAEIXEVLLDAPGVILQDNPSEQLYPMPLYAEGKIDTFVGRIRKDPDMPNGFHLW 320
gi 30020494  241 ATCVRVPVVSGHSESVYIELEKEASVAEIKGILMDAPGVILQDNPSEQLYPMPLYAEGKIDTFVGRIRKDPDTPNGFHLW 320
gi 222096015 241 ATCVRVPVISGHSESVYIELEKEATVAEIKEVLFDAPGVILQDNPSEQLYPMPLYAEGKIDTFVGRIRKDPDTPNGFHLW 320
gi 218897370 241 ATCVRVPVVSGHSESVYIELEKEATVAEIKEVLMDAPGVILQDNPSEQLYPMPLYAEGKIDTFVGRIRKDPDTPNGFHLW 320
gi 217959926 241 ATCVRVPVISGHSESVYIELEKEATVAEIKEVLFDAPGVILQDNPSEQLYPMPLYAEGKIDTFVGRIRKDPDTPNGFHLW 320
gi 225864392 241 ATCVRVPVISGHSESVYIELEKEATVAEIKEVLFDAPGVILQDNPSEQLYPIPLYAEGKIDTFVGRIRKDPDTPNGFHLW 320
gi 118477826 241 ATCVRVPVISGHSESVYIELEKEATVAEIKEVLFDAPGVILQDNPSEQLYPMPLYAEGKIDTFVGRIRKDPDTPNGFHLW 320
gi 296502958 241 ATCVRVPVVSGHSESVYIELEKEATVAEIKEVLMGAPGVILQDNPSEQLYPMPLYAEGKIDTFVGRIRKDPDTPNGFHLW 320
gi 163940205 241 ATCVRVPVVSGHSESVYIELEKEATVAEIKEVLLNAPGVILQDNPSEQIYPTPLYAEGKRDTFVGRIRKDPDTPKGFHLW 320
                        330       340
                 ....*....|....*....|....*..
gi 30262435  321 IVSDNLLKGAAWNSVQIAETMAEEGII 347
gi 42781527  321 IVSDNLLKGAAWNSVQIAETMVEEGII 347
gi 30020494  321 IVSDNLLKGAAWNSVQIAETLVEKGIL 347
gi 222096015 321 IVSDNLLKGAAWNSVQIAETMVEEGII 347
gi 218897370 321 IVSDNLLKGAAWNSVQIAETLVEKGIL 347
gi 217959926 321 IVSDNLLKGAAWNSVQIAETMVEEGII 347
gi 225864392 321 IVSDNLLKGAAWNSVQIAETMVEEGII 347
gi 118477826 321 IVSDNLLKGAAWNSVQIAETMVEEGII 347
gi 296502958 321 IVSDNLLKGAAWNSVQIAETLVEKGIL 347
gi 163940205 321 IVSDNLLKGAAWNSVQIAETLVEKGII 347
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap