Conserved Protein Domain Family
PRK06742

?
PRK06742: PRK06742 
flagellar motor protein MotS; Reviewed
Statistics
?
PSSM-Id: 102525
View PSSM: PRK06742
Aligned: 20 rows
Threshold Bit Score: 417.541
Threshold Setting Gi: 218896660
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30261729    1 MIKRPQKGSPRWMTTFTDLTMLLLTFFVLLVATSKQDAVKLSKMLEKFSDTEQVDAKVMENTIPDISHEKNDEKMISKKR 80
gi 42780820    1 MIKRPQKGSPRWMTTFTDLTMLLLTFFVLLVATSKQDAVKLSKMLEKFSDTEQVDAKVMENTIPDISHEKNDEKMVSKKR 80
gi 30019773    2 MSKGPQKGSPRWMTTFTDLTMLLLTFFVLLVATSKQDAVKLSKMLEKFSDTEQVDAKVMENTIPDISHEKNDEKMISKKR 81
gi 222095352   1 MIKRPQKGSPRWMTTFTDLTMLLLTFFVLLVATSKQDAVKLSKMLEKFSDTEQVDAKVMENTIPDISHEKNDEKTVSKKR 80
gi 218896660   1 MSKGPQKGSPRWMTTFTDLTMLLLTFFVLLVATSKQDAVKLSKMLEKFSDTGQVDAKVMENTIPDISHEKNDEKMISKKR 80
gi 218233445   1 MSKGPQKGSPRWMTTFTDLTMLLLTFFVLLVATSKQDAVKLSKMLEKFSDTGQVDAKVMENTIPDISHEKNDEKMISKKR 80
gi 217959212   1 MIKRPQKGSPRWMTTFTDLTMLLLTFFVLLVATSKQDAVKLSKMLEKFSDTEQVDAKVMENTIPDISHEKNDEKTVSKKR 80
gi 118477164   3 MMKRPQKGSPRWMTTFTDLTMLLLTFFVLLVATSKQDAVKLSKMLEKFSDTEQVDAKVMENTIPDISHEKNDEKMISKKR 82
gi 296502310   1 MSKGPQKGSPRWMTTFTDLTMLLLTFFVLLVATSKQDAVKLSKMLEKFSDTGQVDAKVMENTIPDISHEKNDEKMISKKR 80
gi 49480957    1 MMKRPQKGSPRWMTTFTDLTMLLLTFFVLLVATSKQDAVKLSKMLEKFSDTEQVDAKVMENTIPDISHEKNDEKMISKKR 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30261729   81 MDELYKKLKAYVDNNGISQVNVYREDTGVSVVIVDNLIFDTGDANVKPEAKEIISQLVGFFQSVPNPIVVEGHTDSRPIH 160
gi 42780820   81 MDDLYKKLKAYVDNNGISQVNVYREDTGVSVVIVDNLIFDTGDANVKPEAKEIISKLVGFFQSVPNSIVVEGHTDSRPIH 160
gi 30019773   82 MDELYKKLKAYVDNNGISQVNVYREDTGVSVVIVDNLIFDTGDANVKPEAKGIISQLVGFFQSVPNPIVVEGHTDSRPIH 161
gi 222095352  81 MDDLYKKLKAYVDNNGISQVNVYREDTGVSVVIVDNLIFDTGDANVKPEAKEIISKLVGFFQSVPNSIVVEGHTDSRPIH 160
gi 218896660  81 MDELYKKLKAYVDNNGISQVNVYREDTGVSVVIVDNLIFDTGDANVKPEAKGIISQLVGFFQSVPNPIVVEGHTDSRPIH 160
gi 218233445  81 MDELYKKLKAYVDNNGISQVNVYREDTGVSVVIVDNLIFDTGDANVKPEAKGIISQLVGFFQSVPNPIVVEGHTDSRPIH 160
gi 217959212  81 MDDLYKKLKAYVDNNGISQVNVYREDTGVSVVIVDNLIFDTGDANVKPEAKEIISKLVGFFQSVPNSIVVEGHTDSRPIH 160
gi 118477164  83 MDELYKKLKAYVDNNGISQVNVYREDTGVSVVIVDNLIFDTGDANVKPEAKEIISQLVGFFQSVPNPIVVEGHTDSRPIH 162
gi 296502310  81 MDELYKKLKAYVDNNGISQVNVYREDTGVSVVIVDNLIFDTGDANVKPEAKGIISQLVGFFQSVPNPIVVEGHTDSRPIH 160
gi 49480957   81 MDELYKKLKAYVDNNGISQVNVYREDTGVSVVIVDNLIFDTGDANVKPEAKEIISQLVGFFQSVPNPIVVEGHTDSRPIH 160
                        170       180       190       200       210       220
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 30261729  161 NDKFPSNWELSSARAANMIHHLIEVYNVDDKRLAAVGYADTKPVVPNDSPQNWEKNRRVVIYIKE 225
gi 42780820  161 NEKFPSNWELSSARAANMIHHLIEVYNVEDKRLAAVGYADTKPVVPNDSPQNWEKNRRVVIYIKE 225
gi 30019773  162 NEKFPSNWELSSARAANMIHHLIEVYNVDDKRLAAVGYADTKPIVPNDSPQNWEKNRRVVIYIKE 226
gi 222095352 161 NEKFPSNWELSSARAANMIHHLIEVYNVEDKRLAAVGYADTKPVVPNDSPQNWEKNRRVVIYIKE 225
gi 218896660 161 NEKFPSNWELSSARAANMIHHLIEVYNVDDKRLAAVGYADTKPIVPNDSPQNWEKNRRVVIYIKE 225
gi 218233445 161 NEKFPSNWELSSARAANMIHHLIEVYNVDDKRLAAVGYADTKPIVPNDSPQNWEKNRRVVIYIKE 225
gi 217959212 161 NEKFPSNWELSSARAANMIHHLIEVYNVDDKRLAAVGYADTKPVVPNDSPQNWEKNRRVVIYIKE 225
gi 118477164 163 NDKFPSNWELSSARAANMIHHLIEVYNVDDKRLAAVGYADTKPVVPNDSPQNWEKNRRVVIYIKE 227
gi 296502310 161 NEKFPSNWELSSARAANMIHHLIEVYNVDDKRLAAVGYADTKPIVPNDSPQNWEKNRRVVIYIKE 225
gi 49480957  161 NDKFPSNWELSSARAANMIHHLIEVYNVDDKRLAAVGYADTKPVVPNDSPQNWEKNRRVVIYIKE 225
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap