Conserved Protein Domain Family
PRK06743

?
PRK06743: PRK06743 
flagellar motor protein MotP; Reviewed
Statistics
?
PSSM-Id: 136027
View PSSM: PRK06743
Aligned: 18 rows
Threshold Bit Score: 418.224
Threshold Setting Gi: 30019772
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30261728    1 MGIIVGFAIVIAAIMLGGGGIKAFKNFLDVSSILIVIGGTTATIVVAYRFGEIKKYTKSIFTVLHRREEDLEQLTDLFVD 80
gi 49184554    1 MGIIVGFAIVIAAIMLGGGGIKAFKNFLDVSSILIVIGGTTATIVVAYRFGEIKKYTKSIFTVLHRREEDLEQLTDLFVD 80
gi 47526944    1 MGIIVGFAIVIAAIMLGGGGIKAFKNFLDVSSILIVIGGTTATIVVAYRFGEIKKYTKSIFTVLHRREEDLEQLTDLFVD 80
gi 42780819   24 FGILVGFAIVIAAIMLGGGGIKAFKNFLDVSSILIVIGGTTATIVVAYRFGEIKKYTKSIFTVLHRKEEDLEQLTDLFVD 103
gi 52143731   24 VGIIVGFSIVIAAIMLGGGGIKAFKNFLDVSSILIVIGGTTATIVVAYRFGEIKKYTKSIFTVLHRREEDLEQLTDLFVD 103
gi 222095351  24 FGILVGFAIVIAAIMLGGGGIKAFKNFLDVSSILIVIGGTTATIVVAYRFGEIKKYTKSIFTVLHRKEEDLEQLTDLFVD 103
gi 217959211  24 FGILVGFAIVIAAIMLGGGGIKAFKNFLDVSSILIVIGGTTATIVVAYRFGEIKKYTKSIFTVLHRKEEDLEQLTDLFVD 103
gi 218902842  24 VGIIVGFAIVIAAIMLGGGGIKAFKNFLDVSSILIVIGGTTATIVVAYRFGEIKKYTKSIFTVLHRREEDLEQLTDLFVD 103
gi 118477163  31 VGIIVGFAIVIAAIMLGGGGIKAFKNFLDVSSILIVIGGTTATIVVAYRFGEIKKYTKSIFTVLHRKEEDLEQLTDLFVD 110
gi 49477309   24 VGIIVGFAIVIAAIMLGGGGIKAFKNFLDVSSILIVIGGTTATIVVAYRFGEIKKYTKSIFTVLHRREEDLEQLTDLFVD 103
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30261728   81 FSKKSKKHGLLSLEVDGEQVDNPFIQKGIRLMLSGYDEEELKEVLMKDVETEVYELRKGAALLDKIGDFAPAWGMIGTLI 160
gi 49184554   81 FSKKSKKHGLLSLEVDGEQVDNPFIQKGIRLMLSGYDEEELKEVLMKDVETEVYELRKGAALLDKIGDFAPAWGMIGTLI 160
gi 47526944   81 FSKKSKKHGLLSLEVDGEQVDNPFIQKGIRLMLSGYDEEELKEVLMKDVETEVYELRKGAALLDKIGDFAPAWGMIGTLI 160
gi 42780819  104 FSKKSKKHGLLSLEVDGEQVDNPFIQKGIRLMLSGYDEDELKEVLMKDVETEVYELRKGAVLLDKIGDFAPAWGMIGTLI 183
gi 52143731  104 FSKKSKKHGLLSLEVDGEQVDNPFIQKGIRLMLSGYDEEELKEVLMKDVETEVYELRKGAALLDKIGDFAPAWGMIGTLI 183
gi 222095351 104 FSKKSKKHGLLSLEVDGEQVDNPFIQKGIRLMLSGYDEDELKEVLMKDVETEVYELRKGAVLLDKIGDFAPAWGMIGTLI 183
gi 217959211 104 FSKKSKKHGLLSLEVDGEQVDNPFIQKGIRLMLSGYDEDELKEVLMKDVETEVYELRKGAVLLDKIGDFAPAWGMIGTLI 183
gi 218902842 104 FSKKSKKHGLLSLEVDGEQVDNPFIQKGIRLMLSGYDEDELKEVLMKDVETEVYELRKGAVLLDKIGDFAPAWGMIGTLI 183
gi 118477163 111 FSKKSKKHGLLSLEVDGEQVDNPFIQKGIRLMLSGYDEEELKEVLMKDVETEVYELRKGAALLDKIGDFAPAWGMIGTLI 190
gi 49477309  104 FSKKSKKHGLLSLEVDGEQVDNPFIQKGIRLMLSGYDEDELKEVLMKDVETEVYELRKGAVLLDKIGDFAPAWGMIGTLI 183
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30261728  161 GLIIMLQNLQDTSQIGTGMAVAMLTTLYGSVLANMIAIPLAEKVYRGIEDLYTEKKFVIEAISELYRGQIPSKLKLKLDT 240
gi 49184554  161 GLIIMLQNLQDTSQIGTGMAVAMLTTLYGSVLANMIAIPLAEKVYRGIEDLYTEKKFVIEAISELYRGQIPSKLKLKLDT 240
gi 47526944  161 GLIIMLQNLQDTSQIGTGMAVAMLTTLYGSVLANMIAIPLAEKVYRGIEDLYTEKKFVIEAISELYRGQIPSKLKLKLDT 240
gi 42780819  184 GLIIMLQNLQDTSQIGTGMAVAMLTTLYGSVLANMIAIPLAEKVYRGIEDLYTEKKFVIEAISELYRGQIPSKLKLKLDT 263
gi 52143731  184 GLIIMLQNLQDTSQIGTGMAVAMLTTLYGSVLANMIAIPLAEKVYRGIEDLYTEKKFVIEAISELYRGQIPSKLKLKLDT 263
gi 222095351 184 GLIIMLQNLQDTSQIGTGMAVAMLTTLYGSVLANMIAIPLAEKVYRGIEDLYTEKKFVIEAISELYRGQIPSKLKLKLDT 263
gi 217959211 184 GLIIMLQNLQDTSQIGTGMAVAMLTTLYGSVLANMIAIPLAEKVYRGIEDLYTEKKFVIEAISELYRGQIPSKLKLKLDT 263
gi 218902842 184 GLIIMLQNLQDTSQIGTGMAVAMLTTLYGSVLANMIAIPLSEKVYRGIEDLYTEKKFVIEAISELYRGQIPSKLKLKLDT 263
gi 118477163 191 GLIIMLQNLQDTSQIGTGMAVAMLTTLYGSVLANMIAIPLAEKVYRGIEDLYTEKKFVIEAISELYRGQIPSKLKLKLDT 270
gi 49477309  184 GLIIMLQNLQDTSQIGTGMAVAMLTTLYGSVLANMIAIPLSEKVYRGIEDLYTEKKFVIEAISELYRGQIPSKLKLKLDT 263
                        250
                 ....*....|....
gi 30261728  241 YVYETKIKKVKRAA 254
gi 49184554  241 YVYETKIKKVKRAA 254
gi 47526944  241 YVYETKIKKVKRAA 254
gi 42780819  264 YVYETKIKKVKRAA 277
gi 52143731  264 YVYETKIKKVKRAA 277
gi 222095351 264 YVYETKIKKVKRAA 277
gi 217959211 264 YVYETKIKKVKRAA 277
gi 218902842 264 YVYETKIKKVKRAA 277
gi 118477163 271 YVYETKIKKVKRAA 284
gi 49477309  264 YVYETKIKKVKRAA 277
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap