Conserved Protein Domain Family
PRK06746

?
PRK06746: PRK06746 
peptide chain release factor 2; Provisional
Statistics
?
PSSM-Id: 75726
View PSSM: PRK06746
Aligned: 17 rows
Threshold Bit Score: 639.472
Threshold Setting Gi: 152977397
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49188023    1 MMGAGFWDDQQGAQAVINEANALKDMVGKFRQLDETFENLEITHELLKEEYDEDLHEELESEVKGLIQEMNEYELQLLLS 80
gi 227817946  55 MMGAGFWDDQQGAQAVINEANALKDMVGKFRQLDETFENLEITHELLKEEYDEDLHEELESEVKGLIQEMNEYELQLLLS 134
gi 229604792  55 MMGAGFWDDQQGAQAVINEANALKDMVGKFRQLDETFENLEITHELLKEEYDEDLHEELESEVKGLIQEMNEYELQLLLS 134
gi 222098640   1 MMGAGFWDDQQGAQAVINEANALKDMVGSFRQLDETFENLEITHELLKEEYDEDLHEELESEVKGLIQEMNEYELQLLLS 80
gi 218900306  55 MMSAGFWDDQQGAQAVINEANALKDMVGSFRQLDETFENLEVTHELLKEEYDEDLHEELESEVKGLIQEMNEYELQLLLS 134
gi 217962667  55 MMGAGFWDDQQGAQAVINEANALKDMVGSFRQLDETFENLEITHELLKEEYDEDLHEELESEVKGLIQEMNEYELQLLLS 134
gi 225867150  55 MMGAGFWDDQQGAQAVINEANALKDMVGKFRQLDETFENLEITHELLKEEYDEELHEELESEVKGLIQEMNEYELQLLLS 134
gi 118480225   1 MMGAGFWDDQQGAQAVINEANALKDMVGKFRQLDETFENLEITHELLKEEYDEDLHEELESEVKGLIQEMNEYELQLLLS 80
gi 296505600   1 MMGAGFWDDQQGAQAVINEANALKDMVGKFRQLDETFENLEITHELLKEEYDEDLHEELESEVKGLIQEMNEYELQLLLS 80
gi 49478907    1 MMGAGFWDDQQGAQAVINEANALKDMVGKFRQLDETFENLEITHELLKEEYDEDLHEELESEVKGLIQEMNEYELQLLLS 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49188023   81 DPYDKNKAILELHPGAGGTESQDWGSMLLRMYTRWAEKRGFKVETVDYLPGDEAGIKSVTLLIKGHNAYGYLKAEKGVHR 160
gi 227817946 135 DPYDKNKAILELHPGAGGTESQDWGSMLLRMYTRWAEKRGFKVETVDYLPGDEAGIKSVTLLIKGHNAYGYLKAEKGVHR 214
gi 229604792 135 DPYDKNKAILELHPGAGGTESQDWGSMLLRMYTRWAEKRGFKVETVDYLPGDEAGIKSVTLLIKGHNAYGYLKAEKGVHR 214
gi 222098640  81 DPYDKNNAILELHPGAGGTESQDWGSMLLRMYTRWAEKRGFKVETVDYLPGDEAGIKSVTLLIKGHNAYGYLKAEKGVHR 160
gi 218900306 135 DPYDKNNAILELHPGAGGTESQDWGSMLLRMYTRWAEKRGFKVETVDYLPGDEAGIKSVTLLIKGHNAYGYLKAEKGVHR 214
gi 217962667 135 DPYDKNNAILELHPGAGGTESQDWGSMLLRMYTRWAEKRGFKVETVDYLPGDEAGIKSVTLLIKGHNAYGYLKAEKGVHR 214
gi 225867150 135 DPYDKNNAILELHPGAGGTESQDWGSMLLRMYTRWAEKRGFKVETVDYLPGDEAGIKSVTLLIKGHNAYGYLKAEKGVHR 214
gi 118480225  81 DPYDKNNAILELHPGAGGTESQDWGSMLLRMYTRWAEKRGFKVETVDYLPGDEAGIKSVTLLIKGHNAYGYLKAEKGVHR 160
gi 296505600  81 DPYDKNNAILELHPGAGGTESQDWGSMLLRMYTRWAEKRGFKVETVDYLPGDEAGIKSVTLLIKGHNAYGYLKAEKGVHR 160
gi 49478907   81 DPYDKNNAILELHPGAGGTESQDWGSMLLRMYTRWAEKRGFKVETVDYLPGDEAGIKSVTLLIKGHNAYGYLKAEKGVHR 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49188023  161 LVRISPFDSSGRRHTSFVSCEVVPEFNDEVEIEVRTEDLKIDTYRASGAGGQHVNTTDSAVRITHTPTNTVVTCQSERSQ 240
gi 227817946 215 LVRISPFDSSGRRHTSFVSCEVVPEFNDEVEIEVRTEDLKIDTYRASGAGGQHVNTTDSAVRITHTPTNTVVTCQSERSQ 294
gi 229604792 215 LVRISPFDSSGRRHTSFVSCEVVPEFNDEVEIEVRTEDLKIDTYRASGAGGQHVNTTDSAVRITHTPTNTVVTCQSERSQ 294
gi 222098640 161 LVRISPFDSSGRRHTSFVSCEVVPEFNDEVEIEIRTEDLKIDTYRASGAGGQHVNTTDSAVRITHTPTNTVVTCQSERSQ 240
gi 218900306 215 LVRISPFDSSGRRHTSFVSCEVVPEFNDEVEIEVRTEDLKIDTYRASGAGGQHVNTTDSAVRITHTPTNTVVTCQSERSQ 294
gi 217962667 215 LVRISPFDSSGRRHTSFVSCEVVPEFNDEVEIEIRTEDLKIDTYRASGAGGQHVNTTDSAVRITHTPTNTVVTCQSERSQ 294
gi 225867150 215 LVRISPFDSSGRRHTSFVSCEVVPEFNDEVEIEVRTEDLKIDTYRASGAGGQHVNTTDSAVRITHTPTNTVVTCQSERSQ 294
gi 118480225 161 LVRISPFDSSGRRHTSFVSCEVVPEFNDEVEIEVRTEDLKIDTYRASGAGGQHVNTTDSAVRITHTPTNTVVTCQSERSQ 240
gi 296505600 161 LVRISPFDSSGRRHTSFVSCEVVPEFNDEVEIEVRTEDLKIDTYRASGAGGQHVNTTDSAVRITHTPTNTVVTCQSERSQ 240
gi 49478907  161 LVRISPFDSSGRRHTSFVSCEVVPEFNDEVEIEVRTEDLKIDTYRASGAGGQHVNTTDSAVRITHTPTNTVVTCQSERSQ 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49188023  241 IKNREHAMKMLKAKLYQKKLEEQQAELDEIRGEQKEIGWGSQIRSYVFHPYSLVKDHRTNTEVGNVQAVMDGEIDPFIDA 320
gi 227817946 295 IKNREHAMKMLKAKLYQKKLEEQQAELDEIRGEQKEIGWGSQIRSYVFHPYSLVKDHRTNTEVGNVQAVMDGEIDPFIDA 374
gi 229604792 295 IKNREHAMKMLKAKLYQKKLEEQQAELDEIRGEQKEIGWGSQIRSYVFHPYSLVKDHRTNTEVGNVQAVMDGEIDPFIDA 374
gi 222098640 241 IKNREHAMKMLKAKLYQKKLEEQQAELDEIRGEQKEIGWGSQIRSYVFHPYSLVKDHRTNTEVGNVQAVMDGEIDPFIDA 320
gi 218900306 295 IKNREHAMKMLKAKLYQKKLEEQQAQLDEIRGEQKEIGWGSQIRSYVFHPYSLVKDHRTNTEVGNVQAVMDGEIDPFIDA 374
gi 217962667 295 IKNREHAMKMLKAKLYQKKLEEQQAELDEIRGEQKEIGWGSQIRSYVFHPYSLVKDHRTNTEVGNVQAVMDGEIDPFIDA 374
gi 225867150 295 IKNREHAMKMLKAKLYQKKLEEQQAELDEIRGEQKEIGWGSQIRSYVFHPYSLVKDHRTNTEVGNVQAVMDGEIDPFIDA 374
gi 118480225 241 IKNREHAMKMLKAKLYQKKLEEQQAELDEIRGEQKEIGWGSQIRSYVFHPYSLVKDHRTNTEVGNVQAVMDGEIDPFIDA 320
gi 296505600 241 IKNREHAMKMLKAKLYQKKLEEQQAELDEIRGEQKEIGWGSQIRSYVFHPYSLVKDHRTNTEVGNVQAVMDGEIDPFIDA 320
gi 49478907  241 IKNREHAMKMLKAKLYQKKLEEQQAELDEIRGEQKEIGWGSQIRSYVFHPYSLVKDHRTNTEVGNVQAVMDGEIDPFIDA 320

                 ....*.
gi 49188023  321 YLRSRI 326
gi 227817946 375 YLRSRI 380
gi 229604792 375 YLRSRI 380
gi 222098640 321 YLRSRI 326
gi 218900306 375 YLRSRI 380
gi 217962667 375 YLRSRI 380
gi 225867150 375 YLRSRI 380
gi 118480225 321 YLRSRI 326
gi 296505600 321 YLRSRI 326
gi 49478907  321 YLRSRI 326
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap