Conserved Protein Domain Family
PRK06755

?
PRK06755: PRK06755 
hypothetical protein; Validated
Statistics
?
PSSM-Id: 102532
View PSSM: PRK06755
Aligned: 14 rows
Threshold Bit Score: 410.962
Threshold Setting Gi: 218231078
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 42780519    1 MLFFLKKWNELKDVKSELALRDWFYGTKISLSLCTSKEPLTFLVNVEGRDKGLFSEEDFIVVNCMCEPVFENEEKPAAES 80
gi 52144006    1 MLFFLKKWNELKDVKSELALRDWFYGTKISLSLCTSKEPLTFLVNVEGRDKGLFSEEDFIVVNCMCEPVFENEEKPAAES 80
gi 49477189    1 MLFFLKKWNELKDVKSELALRDWFYGTKISLSLCTSKEPLTFLVNVEGRDKGLFSEEDFIVVNCMCEPVFENEEKPAVES 80
gi 118476902   1 MLFFLKKWNELKDVKSELALRDWFYGTKISLSLCTSKEPLTFLVNVEGRDKGLFSEEDFIVVNCMCEPVFENEEKPAVES 80
gi 163939237   1 MLFFLKKWNELKDVKAELALRDWFYGTKISLSMCTSKEPLTFLVNVEGRDKGVFSEEDFIVVNCMCEPVFENEEKPAIES 80
gi 217958906   1 MLFFLKKWNELKDVKSELALRDWFYGTKISLSLCTSKEPLTFLVNVEGRDKGLFSEEDFIVVNCMCEPVFENEEKPAAES 80
gi 218902537   1 MLFFLKKWNELKDVKSELALRDWFYGTKISLSLCTSKEPLTFLVNVEGRDKGLFSEEDFIVVNCMCEPVFENEEKPAVES 80
gi 222095063   1 MLFFLKKWNELKDVKSELALRDWFYGTKISLSLCTSKEPLTFLVNVEGRDKGLFSEEDFIVVNCMCEPVFENEEKPAAES 80
gi 225863293   1 MLFFLKKWNELKDVKSELALRDWFYGTKISLSLCTSKEPLTFLVNVEGRDKGLFSEEDFIVVNCMCEPVFENEEKPAVES 80
gi 301052970   1 MLFFLKKWNELKDVKSELALRDWFYGTKISLSLCTSKEPLTFLVNVEGRDKGLFSEEDFIVVNCMCEPVFENEEKPAVES 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 42780519   81 FMHADIYKKSSAECILQVQTVDSHLISELYGEKGEVTFDKRSVERVFGKEGITEMTIPIVEDEKKFADLLENNVPNFSEG 160
gi 52144006   81 FMHADIYKKSSAECILQVQTVDSHLISELYGETGEVTFDKRSVERVFGKEGITEMTIPIVEDEKKFANLLENNVPNFIEG 160
gi 49477189   81 FMHADIYKKSRAECILQVQTVDSHLISELYGEEGEVTFDKRSVERVFGKEGITEMTIPIVEDEKKFADLLENNVPNFIEG 160
gi 118476902  81 FMHADIYKKSRAECILQVQTVDSHLISELYGEEGEVTFDKRSVERVFGKEGITEMTIPIVEDEKKFADLLENNVPNFIEG 160
gi 163939237  81 FMHADIYKKSSAECILQVQTVDSHLMSELYGKEGEVTFEKRSVERVFGKDGITEMTIPIVEDEKKFANLLENNVPNFIEG 160
gi 217958906  81 FMHADIYKKSSAECILQVQTVDSHLISELYGEKGEVTFDKRSVERVFGKEGITEMTIPIVEDEKKFADLLENNVPNFIEG 160
gi 218902537  81 FMHADIYKKSRAECILQVQTVDSHLISELYGEEGEVTFDKRSVERVFGKEGITEMTIPIVEDEKKFADLLENNVPNFIEG 160
gi 222095063  81 FMHADIYKKSSAECILQVQTVDSHLISELYGEKGEVTFDKRSVERVFGKEGITEMTIPIVEDEKKFADLLENNVPNFIEG 160
gi 225863293  81 FMHADIYKKSRAECILQVQTVDSHLISELYGEEGEVTFDKRSVERVFGKEGITEMTIPIVEDEKKFADLLENNVPNFIEG 160
gi 301052970  81 FMHADIYKKSRAECILQVQTVDSHLISELYGEEGEVTFDKRSVERVFGKEGITEMTIPIVEDEKKFADLLENNVPNFIEG 160
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....*....
gi 42780519  161 GGVVLVHNYGMIVWGKTPEYAKKWLEGIEYLMNYHVKLLMIKGAKSSVI 209
gi 52144006  161 GGVVLVHNYGMIVWGKTPEEAKKWLEGIEYLMNYHVKLLMIKGAKSSVI 209
gi 49477189  161 GGVVLVHNYGMIVWGKTPEEAKKWLEGIEYLMNYHVKLLMIKGAKSSVI 209
gi 118476902 161 GGVVLVHNYGMIVWGKTPEEAKKWLEGIEYLMNYHVKLLMIKGAKSSVI 209
gi 163939237 161 GGVVLVHNYGMIVWGKTPEEAKKWLEGIEYLMNYHVKLLMIKGAKSSVI 209
gi 217958906 161 GGVVLVHNYGMIVWGKTPEYAKKWLEGIEYLMNYHVKLLMIKGAKSSVI 209
gi 218902537 161 GGVVLVHNYGMIVWGKTPEEAKKWLEGIEYLMNYHVKLLMIKGAKSSVI 209
gi 222095063 161 GGVVLVHNYGMIVWGKTPEYAKKWLEGIEYLMNYHVKLLMIKGAKSSVI 209
gi 225863293 161 GGVVLVHNYGMIVWGKTPEEAKKWLEGIEYLMNYHVKLLMIKGAKSSVI 209
gi 301052970 161 GGVVLVHNYGMIVWGKTPEEAKKWLEGIEYLMNYHVKLLMIKGAKSSVI 209
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap