Conserved Protein Domain Family
PRK06764

?
PRK06764: PRK06764 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 102540
View PSSM: PRK06764
Aligned: 19 rows
Threshold Bit Score: 194.008
Threshold Setting Gi: 152976128
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
30263746    1 MKKIKKFAGVALAGTIGLSGLLFLEPSVSAAESQQVKEENFNAIDVSMNINELYVLSGRSIDVLSGDKEAIQLNKYTIRF 80 
42782827    1 MKQIKKFAGVALAGTIGLSGLLFLEPSVSAAEVQQMKEENFNAIDVSMNLNELYVLSGRSIDVLSGDKEAIQLNKYTIRF 80 
30021838   13 MKQIKKFAGVALAGTIGLSGLLFLEPSVSVAEAQQVKVENFNTIDVTMNLNELYVLSGRSIDILSGDKEAIQLNKYTISF 92 
217961167   1 MKQIKKFAGVALAGTIGLSGLLFLEPSISAAELQQVKEENFNAIDVSMNLNELYVLSGRSIDILSGDKEAIQLNKYTIRF 80 
218236110   1 MKQIKKFAGVALAGTIGLSGLLFLEPSVSVAEAQQVKVKNFNTIDVTMNLNELYVLSGRSIDILSGDKEAIQLNKYTISF 80 
218898846   1 MKQIKKFAGVALAGTIGLSGLLFLEPSVSVAEAQQVKVENFNTIDVTMDLNELYVLSGRSIDILSGDKEAIQLNKYTISF 80 
222097199   1 MKQIKKFAGVALAGTIGLSGLLFLEPSISAAELQQVKEENFNAIDVSMNLNELYVLSGRSIDILSGDKEAIQLNKYTIRF 80 
225865723   1 MKKIKKFAGVALAGTIGLSGLLFLEPSVSVAESQQVKEENFNAIDVSMNINELYVLSGRSIDVLSGDKEAIQLNKYTIRF 80 
229604555   1 MKKIKKFAGVALAGTIGLSGLLFLEPSVSAAESQQVKEENFNAIDVSMNINELYVLSGRSIDVLSGDKEAIQLNKYTIRF 80 
301055235   1 MKKIKKFAGVALAGTIGLSGLLFLEPSVSVAESQQVKEENFNAIDVSMNLNELYVLSGRSIDVLSGDKEAIQLNKYTIRF 80 
30263746   81 SKPGKYVIRVNGCIYNDVYTFIVNE 105
42782827   81 SKPGKYVIRVNGCIYNDVYTFIVNE 105
30021838   93 NKPGKYVIKVNGCIYDDVYTFIVNE 117
217961167  81 SKPGKYVIRVNGCIYNDVYTFIVNG 105
218236110  81 NKPGKYVIKVNGCIYDDVYTFIVNE 105
218898846  81 NKPGKYVIKVNGCIYDDVYTFIVNE 105
222097199  81 SKPGKYVIRVNGCIYNDVYTFIVNG 105
225865723  81 SKPGKYVIRVNGCIYNDVYTFIVNE 105
229604555  81 SKPGKYVIRVNGCIYNDVYTFIVNE 105
301055235  81 SKPGKYVIRVNGCIYNDVYTFIVNE 105
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap