Conserved Protein Domain Family
PRK06772

?
PRK06772: PRK06772 
salicylate synthase Irp9; Reviewed
Statistics
?
PSSM-Id: 102546
View PSSM: PRK06772
Aligned: 20 rows
Threshold Bit Score: 875.987
Threshold Setting Gi: 218689971
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157145183   1 MKISEFLHLALPEEQWLPTISGVLRQFAEEECYVYERQPCWYLGKGCQARLHINADGTQATFIDDAGEQKWAVDSIADCA 80
gi 157145510   1 MKISEFLHLALPEEQWLPTISGVLRQFAEEECYVYERQPCWYLGKGCQARLHINADGTQATFIDDAGEQKWAVDSIADCA 80
gi 26248271    1 MKISEFLHLALPEEQWLPTISGVLRQFVEEECYVYERQPCWYLGKGCQARLHINADGTQATFIDDAGEQKWAVDSIADCA 80
gi 110642108   1 MKISEFLHLALPEEQWLPTISGVLRQFVEEECYVYERQPCWYLGKGCQARLHINADGTQATFIDDAGEQKWAVDSIADCA 80
gi 218695581   1 MKISEFLHLALPEEQWLPTISGVLRQFAEEECYVYERQPCWYLGKGCQARLHINADGTQATFIDDAGEQKWAVDSIADCA 80
gi 218699464   1 MKISEFLHLALPEEQWLPTISGVLRQFAEEECYVYERQPCWYLGKGCQARLHINADGTQATFIDDAGEQKWAVDSIADCA 80
gi 238895508   1 MKISEFLHLALPEEQWLPTISGVLRQFAEEECYVYERQPCWYLGKGCQARLHINADGTQATFIDDAGEQKWAVDSIADCA 80
gi 45441473    1 MKISEFLHLALPEEQWLPTISGVLRQFAEEECYVYERQPCWYLGKGCQARLHINADGTQATFIDDAGEQKWAVDSIADCA 80
gi 51595938    1 MKISEFLHLALPEEQWLPTISGVLRQFAEEECYVYERQPCWYLGKGCQARLHINADGTQATFIDDAGEQKWAVDSIADCA 80
gi 186895032   1 MKISEFLHLALPEEQWLPTISGVLRQFAEEECYVYERQPCWYLGKGCQARLHINADGTQATFIDDAGEQKWAVDSIADCA 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157145183  81 RRFMAHPQVKGRRVYGQVGFNFAAHARGIAFNAGEWPLLTLTVPREELIFEKGNVTVYADSADGCRRLCEWVKEAGTTTQ 160
gi 157145510  81 RRFMAHPQVKGRRVYGQVGFNFAAHARGIAFNAGEWPLLTLTVPREELIFEKGNVTVYADSADGCRRLCEWVKEAGTTTQ 160
gi 26248271   81 RRFMAHPQVKGRRVYGQVGFNFAAHARGIAFNAGEWPLLTLTVPREELIFEKGNVTVYADSADGCRRLCEWVKEAGTTTQ 160
gi 110642108  81 RRFMAHPQVKGRRVYGQVGFNFAAHARGIAFNAGEWPLLTLTVPREELIFEKGNVTVYADSADGCRRLCEWVKEAGTTTQ 160
gi 218695581  81 RRFMAHPQVKGRRVYGQVGFNFAAHARGIAFNAGEWPLLTLTVPREELIFEKGNVTVYADSADGCRRLCEWVKEAGTTTQ 160
gi 218699464  81 RRFMAHPQVKGRRVYGQVGFNFAAHARGIAFNVGEWPLLTLTVPREELIFEKGNVTVYADSADGCRRLCEWVKEAGTTTQ 160
gi 238895508  81 RRFMAHPQVKGRRVYGQVGFNFAAHARGIAFNAGEWPLLTLTVPREELIFEKGNVTVYADSADGCRRLCEWVKEAGTTTQ 160
gi 45441473   81 RRFMAHPQVKGRRVYGQVGFNFAAHARGIAFNAGEWPLLTLTVPREELIFEKGNVTVYADSADGCRRLCEWVKEAGTTTQ 160
gi 51595938   81 RRFMAHPQVKGRRVYGQVGFNFAAHARGIAFNAGEWPLLTLTVPREELIFEKGNVTVYADSADGCRRLCEWVKEAGTTTQ 160
gi 186895032  81 RRFMAHPQVKGRRVYGQVGFNFAAHARGIAFNAGEWPLLTLTVPREELIFEKGNVTVYADSADGCRRLCEWVKEAGTTTQ 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157145183 161 NAPLAVDTALNGEAYKQQVVRAVAEIRRGEYVKVIVSRAIPLPSRIDMPATLLYGRQANTPVRSFMFRQEGREALGFSPE 240
gi 157145510 161 NAPLAVDTALNGEAYKQQVVRAVAEIRRGEYVKVIVSRAIPLPSRIDMPATLLYGRQANTPVRSFMFRQEGREALGFSPE 240
gi 26248271  161 NAPLAVDTALNGEAYKQQVARAVAEIRRGEYVKVIVSRAIPLPSRIDMPATLLYGRQANTPVRSFMFRQEGREALGFSPE 240
gi 110642108 161 NAPLAVDTALNGEAYKQQVARAVAEIRRGEYVKVIVSRAIPLPSRIDMPATLLYGRQANTPVRSFMFRQEGREALGFSPE 240
gi 218695581 161 NAPLAVDTALNGEAYKQQVARAVAEIRRGEYVKVIVSRAIPLPSRIDMPATLLYGRQANTPVRSFMFRQEGREALGFSPE 240
gi 218699464 161 NAPLAVDTALNGETYKQQVARAVAEIRRGEYVKVIVSRAIPLPSRIDMPATLLYGRQANTPVRSFMFRQEGREALGFSPE 240
gi 238895508 161 NAPLAVDTALNGEAYKQQVARAVAEIRRGEYVKVIVSRAIPLPSQIDMPATLLYGRQANTPVRSFMFRQEGREALGFSPE 240
gi 45441473  161 NAPLAVDTALNGEAYKQQVARAVAEIRRGEYVKVIVSRAIPLPSRIDMPATLLYGRQANTSVRSFMFRQEGREALGFSPE 240
gi 51595938  161 NAPLAVDTALNGEAYKQQVARAVAEIRRGEYVKVIVSRAIPLPSRIDMPATLLYGRQANTPVRSFMFRQEGREALGFSPE 240
gi 186895032 161 NAPLAVDTALNGEAYKQQVARAVAEIRRGEYVKVIVSRAIPLPSRIDMPATLLYGRQANTPVRSFMFRQEGREALGFSPE 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157145183 241 LVMSVTGNKVVTEPLAGTRDRMGNPEHNKAKEAELLHDSKEVLEHILSVKEAIAELEAVCQPGSVVVEDLMSVRQRGSVQ 320
gi 157145510 241 LVMSVTGNKVVTEPLAGTRDRMGNPEHNKAKEAELLHDSKEVLEHILSVKEAIAELEAVCQPGSVVVEDLMSVRQRGSVQ 320
gi 26248271  241 LVMSVTGNKVVTEPLAGTRDRMGNPEHNKAKEAELLHDSKEVLEHILSVKEAIAELEAVCQPGSVVVEDLMSVRQRGSVQ 320
gi 110642108 241 LVMSVTGNKVVTEPLAGTRDRMGNPEHNKAKEAELLHDSKEVLEHILSVKEAIAELEAVCQPGSVVVEDLMSVRQRGSVQ 320
gi 218695581 241 LVMSVTGNKVVTEPLAGTRDRMGNPEHNKAKEAELLHDSKEVLEHILSVKEAIAELEAVCQPGSVVVEDLMSVRQRGSVQ 320
gi 218699464 241 LVMSVTGNKVVTEPLAGTRDRMGNPEHNKAKEAELLHDSKEVLEHILSVKEAIAELEAVCQPGSVVVEDLMSVRQRGSVQ 320
gi 238895508 241 LVMSVTGNKVVTEPLAGTRDRMGNPEHNKAKEAELLHDSKEVLEHILSVKEAIAELEAVCQPGSVVVEDLMSVRQRGSVQ 320
gi 45441473  241 LVMSVTGNKVVTEPLAGTRDRMGNPEHNKAKEAELLHDSKEVLEHILSVKEAIAELEAVCQPGSVVVEDLMSVRQRGSVQ 320
gi 51595938  241 LVMSVTGNKVVTEPLAGTRDRMGNPEHNKAKEAELLHDSKEVLEHILSVKEAIAELEAVCQPGSVVVEDLMSVRQRGSVQ 320
gi 186895032 241 LVMSVTGNKVVTEPLAGTRDRMGNPEHNKAKEAELLHDSKEVLEHILSVKEAIAELEAVCQPGSVVVEDLMSVRQRGSVQ 320
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157145183 321 HLGSGVSGQLAENKDAWDAFTVLFPSITASGIPKNAALNAIMQIENTPRELYSGAILLLDDTRFDAALVLRSVFQDSQRS 400
gi 157145510 321 HLGSGVSGQLAENKDAWDAFTVLFPSITASGIPKNAALNAIMQIENTPRELYSGAILLLDDTRFDAALVLRSVFQDSQRS 400
gi 26248271  321 HLGSGVSGQLAENKDAWDAFTVLFPSITASGIPKNAALNAIMQIEKTPRELYSGAILLLDDTRFDAALVLRSVFQDSQRC 400
gi 110642108 321 HLGSGVSGQLAENKDAWDAFTVLFPSITASGIPKNAALNAIMQIEKTPRELYSGAILLLDDTRFDAALVLRSVFQDSQRC 400
gi 218695581 321 HLGSGVSGQLSENKDAWDAFTVLFPSITASGIPKNAALNAIMQIEKTPRELYSGAILLLDDTRFDAALVLRSVFQDSQRS 400
gi 218699464 321 HLGSGVSGQLAENKDAWDAFTVLFPSITASGIPKNAALNAIMQIEKTPRELYSGAILLLDDTRFDAALVLRSVFQDSQRC 400
gi 238895508 321 HLGSGVSGQLAENKDAWDAFTVLFPSITASGIPKNAALNAIMQIEKTPRELYSGAILLLDDTRFDAALVLRSVFQDSQRC 400
gi 45441473  321 HLGSGVSGQLAENKDAWDAFTVLFPSITASGIPKNAALNAIMQIEKTPRELYSGAILLLDDTRFDAALVLRSVFQDSQRC 400
gi 51595938  321 HLGSGVSGQLAENKDAWDAFTVLFPSITASGIPKNAALNAIMQIEKTPRELYSGAILLLDDTRFDAALVLRSVFQDSQRC 400
gi 186895032 321 HLGSGVSGQLAENKDAWDAFTVLFPSITASGIPKNAALNAIMQIEKTPRELYSGAILLLDDTRFDAALVLRSVFQDSQRC 400
                        410       420       430
                 ....*....|....*....|....*....|....
gi 157145183 401 WIQAGAGIIAQSTPERELTETREKLASIAPYLMV 434
gi 157145510 401 WIQAGAGIIAQSTPERELTETREKLASIAPYLIA 434
gi 26248271  401 WIQAGAGIIAQSTPERELTETREKLASIAPYLMV 434
gi 110642108 401 WIQAGAGIIAQSTPERELTETREKLASIAPYLMV 434
gi 218695581 401 WIQAGAGIIAQSTPERELTETREKLASIAPYLMV 434
gi 218699464 401 WIQAGAGIIAQSTPERELTETREKLASIAPYLMV 434
gi 238895508 401 WIQAGAGIIAQSTPERELTETREKLASIAPYLMV 434
gi 45441473  401 WIQAGAGIIAQSTPERELTETREKLASIAPYLMV 434
gi 51595938  401 WIQAGAGIIAQSTPERELTETREKLASIAPYLMV 434
gi 186895032 401 WIQAGAGIIAQSTPERELTETREKLASIAPYLMV 434
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap